KEGG   Verticillium alfalfae: VDBG_07952Help
Entry
VDBG_07952        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
val  Verticillium alfalfae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:val00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    VDBG_07952
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     VDBG_07952
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VDBG_07952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 953 aa AA seqDB search
MGSNGGMGASHRGTPLPHIDDLTSQPVDMDMQLPLRKILDRTDGALKSAEALRDFGRPAE
ALREFIQAATITVRLIPTHPEYVSVQAGRPELKRMYNNLLSKINEQHPTFEKIKAAIIED
NKRSGVRPLSRPAQPDNRKEWEGPGSVPTDTNGKPKPVIQPKPLSLQGRPTAKNVSDLQA
RFKNLGGPRAFSGQDPRIKTHPHAITTDHPSFFQPGINHTDLPKPPQAIFNPATGKTLED
AAAALPSSTNSLYTTGPPSVSAKSGHAGTNDYFGPVRASTGDSSVGKIPAGGTSEARTPQ
RKDTMPKPKFTIPETEKITVDELLNLQKTARVLLIDVRQREAYDEGHIPSQHIMCIEPST
LTREDVTGSTIEEALVLAPEQDNALFRARDTFDLVVFYDESSTKLPKYVAKKEDGVLLTL
KRALDLLSIGKELPHPSKLLDGGLDAWTDTFGRQNIATTSDTGSIPLILRKAQASVRPTT
SRVKYPGSKNIPQGKIDEWNLRIGNEDQTIRIIRSPGELLRDFSSTGQQSMVSSSPKQPP
RPLTSNSMPQMPQRAAAKPTLSGFTDTSSASTTQALVSKSKSAGQHMTGLNNPHNWCYAN
SLIQSLRLSPGFGGELANKDWDKLYVLPRKSDEKSDHPRLMARIIANLFYWMAEGSFPVM
KAQTLMDYSLSLCNANSVQQFGSARQQDASEFMTWLMDALHQETNTKRDKEGQEKYESPD
MRNDKSLIQGASEWWNKYSVANQSIIDRYWRGVQAQVVTCTKCNNKTLSWTPVDTIMLHI
DSPKLQTLEQCLSLNSNEEVLDGYRCDNCQSNSRAMKAVYYPRLPELLCISLSRFSVAEG
KVSRNITWNLNKLNMEPYTADHRIPTDRTEHPPPQYEYECYAVIIHAGRDISSGHYFTYA
RDLTLADSSMWYKLNDSRISKVGRQPEIFGNSNDTPYLAFFRRKQSGSSGGKL
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaacggaggaatgggtgctagccaccgcgggacgccgttgccgcacatcgat
gacttgacttcgcagccagtcgacatggacatgcagctacctctgcgcaagattctcgac
agaaccgatggcgctctcaagtccgccgaggcacttcgcgatttcggtcgccctgctgaa
gccctccgcgagttcatccaggccgccaccatcaccgttcgtctgataccaacacatccc
gaatacgtatcggttcaggctggtcgcccggagctcaagcgcatgtacaacaacctttta
agcaagatcaacgagcagcaccctacattcgagaagatcaaggctgccattatcgaggat
aacaaacggagtggtgtgcggcccctgtcgcgccctgcgcaacccgacaatcgaaaggag
tgggaagggccaggatcagtgccgactgatacgaatggaaagccgaaacctgtcatccag
cccaagcctctatcactgcagggccgtcccacagcaaagaacgtcagcgatcttcaggca
cggttcaagaacctaggaggccctcgtgctttctctggacaggaccctcgaatcaaaacc
cacccacacgctatcacgacggatcatccgtcattcttccaacccggcataaatcataca
gaccttcccaagccgccacaagctatcttcaaccctgccactggaaaaactcttgaggat
gccgctgctgccctgccttcaagcaccaattcattatatactactggaccaccatctgta
tctgcgaagtctgggcacgcaggaacaaatgattattttggacccgtccgcgcttccaca
ggagactcttctgttgggaaaatacccgctggaggaacctctgaagcgaggacaccccaa
cggaaagacaccatgcccaaaccaaaattcacgatccctgaaacagagaagatcaccgtc
gacgaactgctgaacttgcaaaagactgcacgcgtgcttctcatagacgttcggcaacgc
gaggcttatgacgagggccacataccatcgcagcacataatgtgtatcgagccatccacc
ctcactcgcgaagacgtgacgggtagtaccatcgaggaagcgttggttttggcaccagag
caagataatgccctcttccgggcgcgagacacgtttgatctcgttgtcttctacgacgaa
agctcaacgaagcttccgaagtatgtagcgaaaaaagaagacggagtcctgttgacgttg
aagcgtgcgctggatttgctttctatcggtaaagagctacctcacccgtccaagctcctg
gatggaggactggatgcatggaccgacacgttcggcaggcaaaacatagcgacgacgtcg
gacactggcagcataccgctcattcttcggaaggcgcaggcatccgtcaggccgactacc
agccgcgtgaaatatcctgggtccaaaaatattcctcaaggtaaaatcgatgagtggaat
ctgcggattggcaacgaggatcaaactattcgcatcatacgctcgcccggagaactcctg
agggacttttccagcactggccagcagtccatggtgtcgagctcgcccaaacaacctcct
cggcctctcacaagcaatagcatgccacaaatgccccagcgagccgccgcaaagccaaca
ctcagcggctttaccgacaccagttctgccagcacgacacaagccttggtcagcaaatca
aagagcgctggtcaacacatgactggactcaataacccccacaactggtgttacgccaac
agtctgatccagtcgctgcgcctgtcgcctgggttcggaggagagctggcgaacaaggat
tgggataaattgtacgtgttgccacgaaagtcggacgagaagagtgaccatccacggttg
atggcccgcatcattgcgaacctgttctactggatggcagaaggcagcttccctgtgatg
aaggcacagacattgatggactactctctgtcgctttgcaacgccaattccgttcagcaa
tttggcagcgctcgccagcaagatgcctccgagtttatgacctggctcatggatgcgctg
caccaagagacgaataccaagcgcgacaaggagggtcaggaaaagtacgaaagccccgac
atgcgtaacgacaagtccttaatacagggcgcctcggagtggtggaacaagtattctgtc
gcaaatcaatccatcattgatcgatactggcggggcgtccaggctcaagtggtgacgtgc
accaagtgcaacaacaaaacgctatcctggactccagttgacacgatcatgctgcacatt
gacagccccaagctgcagaccctcgagcagtgcctgagcctcaatagcaacgaggaggtc
ttggatgggtaccggtgcgacaactgccagagcaactcacgcgccatgaaggctgtctac
taccctcgcctgccggagcttctctgcatctccctcagccgcttcagcgttgccgagggc
aaggtctctcgcaatatcacctggaacctcaacaagctgaatatggagccctacaccgct
gaccaccgtatccccaccgatcggactgaacatcccccaccccagtacgaatacgaatgc
tacgccgtcatcatccacgcgggccgcgatatctcgtcgggtcattactttacgtacgcg
cgcgacttgactttggctgactcgagcatgtggtataagctcaacgactcgcggatctca
aaggtcggcaggcaaccagagatatttggcaacagcaatgacacgccgtacctggcattc
ttccggcgaaagcagtctggctcctcaggaggcaagctgtaa

DBGET integrated database retrieval system