KEGG   Verticillium alfalfae: VDBG_07982Help
Entry
VDBG_07982        CDS       T02227                                 

Definition
(RefSeq) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
val  Verticillium alfalfae
Pathway
val00052  Galactose metabolism
val00500  Starch and sucrose metabolism
val01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VDBG_07982
   00500 Starch and sucrose metabolism
    VDBG_07982
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VDBG_07982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 9529780
NCBI-ProteinID: XP_003001723
UniProt: C9SSV7
AA seq 498 aa AA seqDB search
MSWGHATSQDGLRWTHASSGEPALKPSEPYDKEGIFTGCFWPTGPHGEKDQLTVVYSSIA
ALPIHWTLKHIRNSEGVSLATSTDAGKTWQKSELNPILVGEPEGVEVTGFRDPFLAEWPA
LDRIRGEKSLYGFLSGGVVDKGPTVFLYAIQPDNLTEWKYLGPLVDLAPGFRAPGSWTSD
FGVNWECVNFISLKDGAHEQDFLLMGTEGGVKPRYKEGDEEPLGQWSSWFSGSVEQTAAG
PRLRHEFDGVLDHGSLYAPNSYVHPETQKRITIGWVREDGLPMSRCKARGWTGFLSLPRE
LFLSTTHNVTRGPEITNRGHSFFQDYGERLGWKDCANAGNQAHGRPPNTAPLPSGRVSTQ
AEARRFHIWQSPDGVQRTTVYFIPQAEQIVVDKSLSNTEADVDKSLLDAPFTLLYSLENE
TEKLEKLRLRIFRDGDVLEVFANDRFALTTTVYCDDSCAGISWFLDDEGSHSVFDSVQLW
EDMAGTQGQVLDIGQPHL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggggtcatgcaacgagccaagatggtttgcgttggacacatgcttcctcaggc
gagcccgcactcaaaccgagtgagccctacgacaaggagggcatcttcactggttgcttc
tggcccaccggacctcacggcgagaaagaccaactcaccgtcgtctactcgtccattgcc
gccctgcccatccactggaccttgaagcatatacgcaactccgagggcgtatcgcttgct
acttccactgatgctggcaagacgtggcagaagagcgagctcaaccccatccttgtgggc
gagcccgagggcgtcgaagttaccggcttccgcgacccgttcctcgccgagtggcctgcg
ctcgaccgcattcgcggcgagaagagcctctacggcttcttgtccggcggcgtcgtcgac
aagggccccacggtgttcttgtacgccatccaacctgacaaccttacggagtggaaatat
ctcggtcccctcgttgacctagcgcctggcttccgcgcgcccggttcctggacgagcgat
ttcggcgtcaactgggaatgtgtcaactttatcagcctgaaagatggtgcccacgagcaa
gattttcttctcatgggtaccgaaggaggcgtcaagcccaggtataaggagggcgacgaa
gagccccttggccagtggtcatcgtggttctccggttcggtagagcagactgcggccggc
ccacgtctgcggcacgagtttgacggtgttctggatcacggcagcctgtacgcgcccaac
tcttatgttcatcctgagacgcaaaagaggatcacgataggctgggttcgagaggatggc
ctgccaatgagccgttgcaaagcgaggggctggacgggtttcttgtccctgccacgggaa
ctgttcctctccacgacacacaatgtgaccagggggcctgaaatcaccaatcgaggacat
tcgttctttcaagattatggagagcggctcgggtggaaagactgtgcaaacgctgggaat
caagcccatggacgacctccgaacactgcgcccctcccgtccggcagagtgtcgacccag
gcagaggcgcgtcggtttcacatctggcaaagtcccgacggcgtgcagaggacgactgtg
tacttcatcccccaggccgagcagattgtcgttgacaagagtctctccaataccgaggcg
gatgtcgacaagtcgcttctcgatgcgccctttacacttctctactcgcttgaaaatgag
acggagaagctggagaagcttcgcttgcgcatcttccgtgacggagatgtgcttgaggtc
tttgccaacgatcgctttgcattgaccacaacagtgtactgcgacgattcgtgtgcaggc
atcagctggttcctcgatgacgaggggtcacacagcgtgtttgattcggttcagctgtgg
gaggatatggccggcacgcagggacaggtgcttgatattggacagcctcatctgtaa

DBGET integrated database retrieval system