KEGG   Verticillium alfalfae: VDBG_08006Help
Entry
VDBG_08006        CDS       T02227                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
val  Verticillium alfalfae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VDBG_08006
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    VDBG_08006
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VDBG_08006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 470 aa AA seqDB search
MLRSRGQKKSVMVVAVSSPYDFALDKTIGTYICTFDFTENALNALVRALCGDFVPKGSLP
GTLRKSKKVLKSRQNWIVEEYDRERDADGLHELIKATARANSADLGCLGTATAASFELFN
PKIDETHFVVRNSSTNALYGFAATYAIDRTGILGAIFVDPSKRNHSVGRSLHRRAIRHLT
KKRSIKKVQLGTCFPGIFLGIPIGEGIAASWFANNGWDIQFPKRLTNLVIDDLSTWTVPE
GLLQGIQRASISFDLIHGLDNGDAERVLSHVSQHATAEVLELYRCALQETKACGIVRAKK
ADDTLLGTIIICSPGSPLATYVPPLMPCRGEGIGGVLAPVVPPTSQDVLVLQGLVLMGTR
QNKAHKSAKTVLSWVQDAAYEHVVAMGFEILQSFEEITNTPDTSSLYILRREKARPIRGP
VGAWHGYNGNSPNRPHSMLHIQNLGAQHRLGLNNLPMVPSVQAGSRRRSD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgatcaagaggacagaagaaatctgtcatggtcgttgctgtcagctccccgtac
gactttgctctagacaagaccattggcacctacatctgcactttcgatttcaccgagaac
gccctaaatgccttggtgcgagccctgtgtggagactttgtaccaaaaggcagcttgcca
ggaacactgaggaagagcaagaaggttctgaagtctcgtcaaaattggattgtggaggag
tacgaccgagagcgagacgccgatggccttcatgagctcatcaaagccaccgcacgagcg
aactcggccgatctcggttgcctaggaactgctactgcagcatcgtttgagctcttcaat
ccgaagatcgacgagacgcacttcgtcgtccggaacagcagtacaaacgctttgtacggt
ttcgctgccacgtatgccattgacaggacaggcatcctcggcgccatattcgtggacccc
tccaagagaaatcattccgtgggacggtctctgcaccgaagagccattcgacacctcacc
aagaagcgaagcatcaagaaggtccagcttggtacctgtttcccaggcatatttctcggc
atccccattggggagggcatcgccgcttcctggttcgcaaacaacggttgggacattcaa
tttccaaaacgcctcacgaatcttgtcatcgacgatttgagcacctggaccgttcctgaa
ggtctcttgcaagggattcaacgggcgagcatcagcttcgatctgatacatggtctcgac
aatggtgatgccgaacgggttctttctcatgtcagccagcacgcaactgctgaggtgtta
gagctgtataggtgtgcccttcaggagacaaaagcttgtggcatcgtccgagccaagaag
gcagatgatactttgcttggtacgattataatttgcagccctgggagcccgctggcaact
tatgtcccgccattgatgccatgccgtggagaaggcatcggcggggtgctggcgcccgtc
gtgccaccgacatcccaggacgttctggtgttacaggggctggtgctgatgggcacacga
caaaacaaggcgcacaagtcggccaagacggtgttgagttgggttcaggatgctgcctac
gaacatgttgttgccatgggcttcgaaattcttcagtcattcgaggagatcacgaacact
ccagatacatcgtcgctctatattttaaggcgtgagaaggccaggccgattcggggtcca
gtaggggcgtggcacggttataacggcaacagtccgaaccgaccccattcgatgcttcac
attcagaacctgggtgcacagcacagattgggtcttaacaatttgccgatggttccatca
gtgcaagccggtagccgtcgcagaagtgactga

DBGET integrated database retrieval system