KEGG   Verticillium alfalfae: VDBG_08179Help
Entry
VDBG_08179        CDS       T02227                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
val  Verticillium alfalfae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VDBG_08179
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     VDBG_08179
Transfer RNA biogenesis [BR:val03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    VDBG_08179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 198 aa AA seqDB search
MASYAKELEIAQLAVQRAAILTKRVFHEKAKGTVDKNDKSPVTIGDFGAQALIIAALRHH
FPEDEIVAEEEAAQLRQDDKLKTQIWDLAQIAQRLGITRPRVRMDSQSKYGSIARGAGDI
YLRLPVSASYQEKIWDHAAGDLIVREAGGHVTDIAGQRLDFSVGRTLAKNKGVVAAPAAV
HAEVLKVVQEVLNQKTAA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctacgcgaaagaactcgagatcgcccagctcgccgtccagcgcgctgccatc
ctcacgaagcgcgtcttccacgaaaaagccaagggcaccgtcgacaagaatgacaagtcc
cccgtcaccattggcgactttggcgcccaggccctcatcatcgccgccctgcgccaccat
ttccccgaagacgagattgtcgccgaggaggaggctgcccagctgcgccaggacgacaag
ctcaagacccagatctgggacctcgcccagatcgcccaacggctcggcatcacccgcccc
agggtccgcatggacagccagagcaagtacggcagcatcgcccgcggcgccggcgacatt
tacctgcgcctgcccgtcagcgcctcctaccaggagaagatctgggatcacgccgccggc
gacctcattgtgcgcgaggctggcggccacgtcaccgacattgccggccagaggctcgac
ttctccgtcggccggaccctcgccaagaacaaaggcgtcgtggctgcccctgccgccgtg
cacgccgaggtgctcaaggttgtgcaggaagtgctgaaccagaagacggcggcgtag

DBGET integrated database retrieval system