KEGG   Verticillium albo-atrum: VDBG_08240Help
Entry
VDBG_08240        CDS       T02227                                 

Definition
Lysophospholipase NTE1
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
val  Verticillium albo-atrum
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:val00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1387 aa AA seqDB search
MVITVALVSAVSWVVRYRILNMYSRLPPEPQRKEPEIDLFPDTHDEGVKSGLSSYLDEFL
SAIKIFGYLERPVFHELTRSMQTRKLIAGETFNLEEEKGFCIVVDGMVEIFVKSGRSFGS
PEASANFQGDLLDGEDDALPHGEQYQLLTEVKNGAPMSSLFSIMSLFTEDIKLTSTEAET
PERSTASSANFRFAGAARTSVSRHVSQDAAASMPGTPRFVDVAENNNDRVHEDLSRPSYT
IPSSNQAAIPPISLDGSEPKRTAVRPTLPGRAASTSAHPDIIARATVDTTIAIIPASAFR
RLTKVYPKATSHIVHVILSRFQRVTLATAYRYLGLTSEVLLTEKSMNRYTTWQLPNMLRG
DALLRLKEKFGRERQRAGEDTETKGIALHNANAHRRRKSSVMLRKDAVLHSMSKQTSYVA
TTIAPPGERLATQTPSPGDLLATTNMAREVPGHNFTDSPIEHVAEVMRLDQTSPLAQRTF
NPFASVNTSRVSLDPRDAADEDNLFRTSILECMFRAIGLGVGGTVSREPESMEGSPRLFS
YDQRRHKAMFGNHNAFGIMDPFDGSVDGDTESLTSGGLALNTPPSAQSLANDLRDDVEIV
FFPQGSVLVEQANATPDLLRYRRLPRYLHHHHGRDNAQDKRKKSVRRSVSLIKPGGLAGY
IGALSSYRSFIDVVAKTDVYVGFLPRASLERIVDRYPIILLTMAKRLTSLLPRLLLHIDF
ALDWDQVSAGQVIFHDSDESEAIYIVLNGRLRLVEDREGGGMTVRAEFGQGDSVGELEVL
TESARTGTLHAIRDTELVRFPRTLFNSLAQEHPNITIKISKIIAARMRSLVDDPAQLMAN
EAGLSALGKGSSALNLRTVAVLPVTAGVPVVEFGHRLLNALVQVGPVNGAISLNQSAILN
HLGKHAFNKMGKLKLSQYLADLEEKYGLVVYVADTNVNSPWTQTCIAQADSILLVGLGEG
SPEIGEYERFMLGMKSTARKILVLLHAERYSSPGLTRSWLRNRMWINGGHYHLQMAFRTN
MMPSHPPSKRSNTTLKERVQILQAEIQKYTSRKVRHTPYYSPDAPFKGDFHRLARRLCGK
SVGLVLGGGGARGITQIGIIQAMEEAGIPIDVVGGTSMGSFVGALYARHADIVPIFGLAK
KFSGRMASMWRFALDLTYPTSSYTTGHEFNRGIFKTFGKAQIEDFWLEFYCNTTNISKSR
AEYHTSGYAWRYIRASMSLAGLLPPLSDEGSMLLDGGYIDNLTVSHMKRLGVDTIFAVDV
GSLDDDTPQSYGDSLSGVWAFFNRWNPFSTTPNPPTLAEIQARLAYVSSVDALERAKAMP
GCLYMRPPIDDYGTLDFGKFDEIYQVGYKYGQEFLQKMKDDGVLPLVEETEAKKALRRTM
APRRASI
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaccgtcgcccttgtctccgccgttagctgggtggttcgctatcgcatactc
aacatgtactcgcgattacccccagagcctcaacgcaaggaaccggaaattgatctgttt
cctgacacacatgacgagggtgtcaagtcaggactttcaagctacctggacgagtttctg
agcgctatcaagatattcggttatctcgagcgtcctgtcttccacgagttgactcgaagc
atgcaaacccggaaactcatcgctggtgaaacttttaacctcgaagaggagaaaggtttc
tgcattgtggtcgatgggatggtggaaatctttgtcaagtctgggaggtcctttggctcc
ccagaagcgagcgctaattttcaaggcgacctattagatggagaagacgatgctttgccc
catggtgagcaataccagctgcttacggaggtcaagaatggggcacccatgtcgtcctta
ttctccatcatgtccctttttaccgaggacattaaactcacgtcaacagaggctgaaacc
cccgaaagaagcactgcttccagcgccaatttccgatttgctggggccgcccgaacttcc
gtctcgcggcatgtctcccaggatgccgccgcgtcaatgcctggcacgccgcgatttgtt
gacgtggctgaaaacaacaacgaccgtgtacatgaagacttgtcgcgcccgtcctataca
atccctagctcgaaccaggctgcaattcctccgatttcgctcgatgggtcagagcccaag
cggacagcagtccgccctacactcccaggcagagccgcttcgacatcggcccatccagat
atcatcgctcgggccacagtcgacacgacgattgccataattcctgccagcgcttttcga
cgacttaccaaagtgtatccaaaagccacatcgcacatagttcatgtcattctatcccgc
ttccagcgagtgacacttgccacggcatacagataccttgggttgacgtccgaggtgttg
ttgaccgagaagagcatgaatagatatacaacgtggcagcttcctaacatgcttcggggc
gatgcactgctacgcctcaaggaaaaatttggccgcgagcgtcagcgcgctggggaagat
acggaaaccaagggcatcgcgctacacaatgcgaatgcccatcgacgccgaaagtcaagt
gtcatgctgcgcaaagatgctgttttgcattcaatgtccaagcaaacttcctacgtcgcc
acaactatcgcacccccaggagagagactggctactcagacgcccagtcccggagactta
ttggccactacgaacatggctcgagaagtccctggtcacaatttcacagactcacctatt
gagcatgttgcagaggtcatgcgtctggatcaaaccagccccttggcacagcgaactttc
aaccctttcgctagtgtcaacacttcgcgcgtgtcactcgacccccgagacgccgccgat
gaggacaatctcttccggacctcgatccttgaatgcatgtttcgagcgatcggcctgggc
gtcggcggcactgtttcgcgggaacctgaatccatggagggatcacctaggctattttcg
tatgatcagcgacgccacaaagctatgtttggaaatcacaatgcctttggcatcatggac
cccttcgacggctcggttgatggcgataccgagtcattgacatctggtggccttgccctg
aatactcccccaagcgcccaatcactagccaatgatttgcgtgatgacgtcgagattgtt
ttctttccccaaggctcagttctcgttgagcaagcgaacgcaaccccggacttactacgt
tatcgacggcttcctcgatatctgcaccaccatcatggcagggacaatgctcaagacaag
cgcaagaagtctgtgcgtcgcagtgtatccttgatcaaaccgggtggccttgcaggctac
attggcgcattatcttcgtaccgttcattcatcgatgtcgttgcgaagactgatgtctac
gttggtttcttaccccgtgcgtcccttgaaaggattgtagatcggtaccctatcatcctt
ttgacgatggccaagaggctgacaagtcttttgccgcgccttctccttcacatcgacttt
gctctggattgggatcaggtcagcgctggccaagtcatatttcacgacagcgacgagagt
gaagctatctacattgtcttgaatggacgtcttcgtctcgtcgaagaccgcgaaggcggt
ggcatgactgtacgagccgagtttggccagggcgacagcgtaggtgagctggaagtactt
accgagtcggcccgcaccggaactttacatgccattcgagacacagagcttgtaagattt
ccgcgaacgcttttcaacagcctagctcaagagcacccgaacatcactatcaagatatca
aagatcattgctgcccgcatgcgcagtttggtagatgatccagcccagctaatggcaaat
gaagctgggctctctgcgttaggcaaaggctcgtcggcgctcaacttgcggacagtagct
gtgcttcctgtgaccgcaggcgtaccagttgttgagtttggccatcgtttgttgaatgct
ttggtgcaagtcggcccagtcaacggcgcgatttcattgaaccagtccgcgattctcaac
caccttggcaagcacgctttcaataaaatgggcaagctgaagctatcccaatacctcgcg
gatctggaggaaaagtacggccttgtggtctacgtcgcagacacaaacgtcaattcgccc
tggacgcagacttgtatcgcacaagccgattctatactgctggtgggcttgggcgagggc
tcccctgagattggtgagtacgagcgcttcatgctgggcatgaagtcaaccgcgcgcaag
atcctggttctgctccacgcagagcggtattcgtcacctggtctgaccaggtcctggctt
cgaaaccgaatgtggattaatggcggtcactatcacctgcaaatggcttttagaaccaac
atgatgccatcccaccccccttctaagagatcaaacacgacactgaaggagcgtgtccag
atcttgcaggctgagatccagaaatacacctcgagaaaggttcgacacacaccctactac
tcgcctgatgcaccgttcaagggcgattttcatcgtctggcccgacgattatgtggcaag
tcggtgggtctcgtgctcggaggtggtggcgctcgaggcatcactcagatcggcatcatc
caggctatggaggaagctggcattcccattgatgttgtgggtggaacatcaatgggatcg
tttgttggtgccctctacgcaaggcacgcagacatcgtgcccattttcggcttggcgaag
aaattctcaggccggatggctagtatgtggcgcttcgcgcttgacttgacttacccgaca
tcctcatacaccactgggcacgaattcaaccgcgggattttcaagacttttggcaaggcc
cagattgaagacttctggctcgaattctactgcaataccaccaacatcagcaagagccgg
gcggagtatcataccagtgggtacgcctggcggtacattcgagcgtccatgtctctggcg
gggttacttcctcccctatcagacgaaggaagcatgctattggatggtggctatatcgac
aaccttacggtatctcacatgaagagactaggcgttgatacgatctttgccgtcgatgtc
ggctcgttggatgacgataccccccagagctatggcgactctctttcaggagtttgggcg
ttttttaataggtggaatcccttctcaacaacgcccaacccgcctactctggcggaaatt
caggctcgattagcgtacgtgtccagtgtagacgccctggagcgtgccaaagccatgcct
ggatgcttatacatgcgacctcccatcgacgattatggcacgctcgactttgggaagttc
gatgagatttaccaggtgggctacaaatatggccaagagttcttacagaagatgaaggac
gatggtgtcttgccgctggtcgaagagacggaagccaagaaagcattgcgcaggacaatg
gcacctcgccgcgccagtatttag

DBGET integrated database retrieval system