KEGG   Verticillium alfalfae: VDBG_08240Help
Entry
VDBG_08240        CDS       T02227                                 

Definition
Lysophospholipase NTE1
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
val  Verticillium alfalfae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VDBG_08240
Enzymes [BR:val01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VDBG_08240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1387 aa AA seqDB search
MVITVALVSAVSWVVRYRILNMYSRLPPEPQRKEPEIDLFPDTHDEGVKSGLSSYLDEFL
SAIKIFGYLERPVFHELTRSMQTRKLIAGETFNLEEEKGFCIVVDGMVEIFVKSGRSFGS
PEASANFQGDLLDGEDDALPHGEQYQLLTEVKNGAPMSSLFSIMSLFTEDIKLTSTEAET
PERSTASSANFRFAGAARTSVSRHVSQDAAASMPGTPRFVDVAENNNDRVHEDLSRPSYT
IPSSNQAAIPPISLDGSEPKRTAVRPTLPGRAASTSAHPDIIARATVDTTIAIIPASAFR
RLTKVYPKATSHIVHVILSRFQRVTLATAYRYLGLTSEVLLTEKSMNRYTTWQLPNMLRG
DALLRLKEKFGRERQRAGEDTETKGIALHNANAHRRRKSSVMLRKDAVLHSMSKQTSYVA
TTIAPPGERLATQTPSPGDLLATTNMAREVPGHNFTDSPIEHVAEVMRLDQTSPLAQRTF
NPFASVNTSRVSLDPRDAADEDNLFRTSILECMFRAIGLGVGGTVSREPESMEGSPRLFS
YDQRRHKAMFGNHNAFGIMDPFDGSVDGDTESLTSGGLALNTPPSAQSLANDLRDDVEIV
FFPQGSVLVEQANATPDLLRYRRLPRYLHHHHGRDNAQDKRKKSVRRSVSLIKPGGLAGY
IGALSSYRSFIDVVAKTDVYVGFLPRASLERIVDRYPIILLTMAKRLTSLLPRLLLHIDF
ALDWDQVSAGQVIFHDSDESEAIYIVLNGRLRLVEDREGGGMTVRAEFGQGDSVGELEVL
TESARTGTLHAIRDTELVRFPRTLFNSLAQEHPNITIKISKIIAARMRSLVDDPAQLMAN
EAGLSALGKGSSALNLRTVAVLPVTAGVPVVEFGHRLLNALVQVGPVNGAISLNQSAILN
HLGKHAFNKMGKLKLSQYLADLEEKYGLVVYVADTNVNSPWTQTCIAQADSILLVGLGEG
SPEIGEYERFMLGMKSTARKILVLLHAERYSSPGLTRSWLRNRMWINGGHYHLQMAFRTN
MMPSHPPSKRSNTTLKERVQILQAEIQKYTSRKVRHTPYYSPDAPFKGDFHRLARRLCGK
SVGLVLGGGGARGITQIGIIQAMEEAGIPIDVVGGTSMGSFVGALYARHADIVPIFGLAK
KFSGRMASMWRFALDLTYPTSSYTTGHEFNRGIFKTFGKAQIEDFWLEFYCNTTNISKSR
AEYHTSGYAWRYIRASMSLAGLLPPLSDEGSMLLDGGYIDNLTVSHMKRLGVDTIFAVDV
GSLDDDTPQSYGDSLSGVWAFFNRWNPFSTTPNPPTLAEIQARLAYVSSVDALERAKAMP
GCLYMRPPIDDYGTLDFGKFDEIYQVGYKYGQEFLQKMKDDGVLPLVEETEAKKALRRTM
APRRASI
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaccgtcgcccttgtctccgccgttagctgggtggttcgctatcgcatactc
aacatgtactcgcgattacccccagagcctcaacgcaaggaaccggaaattgatctgttt
cctgacacacatgacgagggtgtcaagtcaggactttcaagctacctggacgagtttctg
agcgctatcaagatattcggttatctcgagcgtcctgtcttccacgagttgactcgaagc
atgcaaacccggaaactcatcgctggtgaaacttttaacctcgaagaggagaaaggtttc
tgcattgtggtcgatgggatggtggaaatctttgtcaagtctgggaggtcctttggctcc
ccagaagcgagcgctaattttcaaggcgacctattagatggagaagacgatgctttgccc
catggtgagcaataccagctgcttacggaggtcaagaatggggcacccatgtcgtcctta
ttctccatcatgtccctttttaccgaggacattaaactcacgtcaacagaggctgaaacc
cccgaaagaagcactgcttccagcgccaatttccgatttgctggggccgcccgaacttcc
gtctcgcggcatgtctcccaggatgccgccgcgtcaatgcctggcacgccgcgatttgtt
gacgtggctgaaaacaacaacgaccgtgtacatgaagacttgtcgcgcccgtcctataca
atccctagctcgaaccaggctgcaattcctccgatttcgctcgatgggtcagagcccaag
cggacagcagtccgccctacactcccaggcagagccgcttcgacatcggcccatccagat
atcatcgctcgggccacagtcgacacgacgattgccataattcctgccagcgcttttcga
cgacttaccaaagtgtatccaaaagccacatcgcacatagttcatgtcattctatcccgc
ttccagcgagtgacacttgccacggcatacagataccttgggttgacgtccgaggtgttg
ttgaccgagaagagcatgaatagatatacaacgtggcagcttcctaacatgcttcggggc
gatgcactgctacgcctcaaggaaaaatttggccgcgagcgtcagcgcgctggggaagat
acggaaaccaagggcatcgcgctacacaatgcgaatgcccatcgacgccgaaagtcaagt
gtcatgctgcgcaaagatgctgttttgcattcaatgtccaagcaaacttcctacgtcgcc
acaactatcgcacccccaggagagagactggctactcagacgcccagtcccggagactta
ttggccactacgaacatggctcgagaagtccctggtcacaatttcacagactcacctatt
gagcatgttgcagaggtcatgcgtctggatcaaaccagccccttggcacagcgaactttc
aaccctttcgctagtgtcaacacttcgcgcgtgtcactcgacccccgagacgccgccgat
gaggacaatctcttccggacctcgatccttgaatgcatgtttcgagcgatcggcctgggc
gtcggcggcactgtttcgcgggaacctgaatccatggagggatcacctaggctattttcg
tatgatcagcgacgccacaaagctatgtttggaaatcacaatgcctttggcatcatggac
cccttcgacggctcggttgatggcgataccgagtcattgacatctggtggccttgccctg
aatactcccccaagcgcccaatcactagccaatgatttgcgtgatgacgtcgagattgtt
ttctttccccaaggctcagttctcgttgagcaagcgaacgcaaccccggacttactacgt
tatcgacggcttcctcgatatctgcaccaccatcatggcagggacaatgctcaagacaag
cgcaagaagtctgtgcgtcgcagtgtatccttgatcaaaccgggtggccttgcaggctac
attggcgcattatcttcgtaccgttcattcatcgatgtcgttgcgaagactgatgtctac
gttggtttcttaccccgtgcgtcccttgaaaggattgtagatcggtaccctatcatcctt
ttgacgatggccaagaggctgacaagtcttttgccgcgccttctccttcacatcgacttt
gctctggattgggatcaggtcagcgctggccaagtcatatttcacgacagcgacgagagt
gaagctatctacattgtcttgaatggacgtcttcgtctcgtcgaagaccgcgaaggcggt
ggcatgactgtacgagccgagtttggccagggcgacagcgtaggtgagctggaagtactt
accgagtcggcccgcaccggaactttacatgccattcgagacacagagcttgtaagattt
ccgcgaacgcttttcaacagcctagctcaagagcacccgaacatcactatcaagatatca
aagatcattgctgcccgcatgcgcagtttggtagatgatccagcccagctaatggcaaat
gaagctgggctctctgcgttaggcaaaggctcgtcggcgctcaacttgcggacagtagct
gtgcttcctgtgaccgcaggcgtaccagttgttgagtttggccatcgtttgttgaatgct
ttggtgcaagtcggcccagtcaacggcgcgatttcattgaaccagtccgcgattctcaac
caccttggcaagcacgctttcaataaaatgggcaagctgaagctatcccaatacctcgcg
gatctggaggaaaagtacggccttgtggtctacgtcgcagacacaaacgtcaattcgccc
tggacgcagacttgtatcgcacaagccgattctatactgctggtgggcttgggcgagggc
tcccctgagattggtgagtacgagcgcttcatgctgggcatgaagtcaaccgcgcgcaag
atcctggttctgctccacgcagagcggtattcgtcacctggtctgaccaggtcctggctt
cgaaaccgaatgtggattaatggcggtcactatcacctgcaaatggcttttagaaccaac
atgatgccatcccaccccccttctaagagatcaaacacgacactgaaggagcgtgtccag
atcttgcaggctgagatccagaaatacacctcgagaaaggttcgacacacaccctactac
tcgcctgatgcaccgttcaagggcgattttcatcgtctggcccgacgattatgtggcaag
tcggtgggtctcgtgctcggaggtggtggcgctcgaggcatcactcagatcggcatcatc
caggctatggaggaagctggcattcccattgatgttgtgggtggaacatcaatgggatcg
tttgttggtgccctctacgcaaggcacgcagacatcgtgcccattttcggcttggcgaag
aaattctcaggccggatggctagtatgtggcgcttcgcgcttgacttgacttacccgaca
tcctcatacaccactgggcacgaattcaaccgcgggattttcaagacttttggcaaggcc
cagattgaagacttctggctcgaattctactgcaataccaccaacatcagcaagagccgg
gcggagtatcataccagtgggtacgcctggcggtacattcgagcgtccatgtctctggcg
gggttacttcctcccctatcagacgaaggaagcatgctattggatggtggctatatcgac
aaccttacggtatctcacatgaagagactaggcgttgatacgatctttgccgtcgatgtc
ggctcgttggatgacgataccccccagagctatggcgactctctttcaggagtttgggcg
ttttttaataggtggaatcccttctcaacaacgcccaacccgcctactctggcggaaatt
caggctcgattagcgtacgtgtccagtgtagacgccctggagcgtgccaaagccatgcct
ggatgcttatacatgcgacctcccatcgacgattatggcacgctcgactttgggaagttc
gatgagatttaccaggtgggctacaaatatggccaagagttcttacagaagatgaaggac
gatggtgtcttgccgctggtcgaagagacggaagccaagaaagcattgcgcaggacaatg
gcacctcgccgcgccagtatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system