KEGG   Verticillium albo-atrum: VDBG_08292Help
Entry
VDBG_08292        CDS       T02227                                 

Definition
replication factor-A protein
Orthology
K10739  
replication factor A2
Organism
val  Verticillium albo-atrum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VDBG_08292
   03420 Nucleotide excision repair
    VDBG_08292
   03430 Mismatch repair
    VDBG_08292
   03440 Homologous recombination
    VDBG_08292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 181 aa AA seqDB search
MDGVAGGPGSGSGVDLDAYVRVWGRIKSFNGKRHVGAHFLRAVTDFNEVNYHLLESTYVH
LFFTKGPLGGAKAEDNGDGMFVDGGGHGNNTSNNNNASHATGQSSKVAQCTPMGQKMYNF
LVNAPGGNEGVHMNVIASGAGMSMRDVLGAADDLLGQGLVYTTIDDETWGHSRVFERVAV
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgtcgccggcggccccggctccggctccggcgtcgacctcgacgcctacgtc
cgcgtctgggggcgtatcaagtccttcaacggcaagaggcacgtcggcgcccactttctg
cgcgccgtcaccgacttcaacgaggtcaactaccacctgctcgagagcacctacgtccac
ctcttcttcaccaaggggcccctcggcggtgccaaggccgaggacaacggcgacggcatg
tttgtcgacggcggcggccacggcaacaacaccagcaacaacaacaacgcatcacacgcc
accggccagtcgagcaaggtcgcccagtgcacgcccatgggccagaagatgtacaacttc
ctcgtcaacgcgccgggcggcaacgagggcgtgcacatgaatgtcattgcgagcggcgcc
ggcatgagcatgcgcgacgtcctcggcgccgccgacgacctactcggccaggggctcgtg
tataccaccatcgacgatgagacgtggggccattctcgagtatttgagcgggtggcggtc
gggtga

DBGET integrated database retrieval system