KEGG   Verticillium albo-atrum: VDBG_08312Help
Entry
VDBG_08312        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MATPNPDPPSTAPAFIPLEANPQLMTTLLHKLGLSSALQIHDVYSLTDPDLLAFIPRPAL
ALLLVFPVSATYESHRLAEDALLDDYKGHGDGAPVVWFRQTIRNACGLMGLLHAVANGPA
RDYIEASSDLDTLLQQALPLHPAERAALLEKSTALANAHRSAASQGDTSAPEATDDVDLH
YVCFVKTTDGAFWELDGRRKGPLQRGQLEESEDVLSTKALTLGPLKFLEREGADLRFSAV
ALAGATD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgaaccccgacccgccgtcgacagccccggccttcatccccctcgaggcg
aaccctcaactcatgaccaccctcctccacaagctcggcctctcctccgccctccagatc
cacgacgtctactccctcacagaccccgacctcctcgccttcatcccccgccccgcgctc
gccctgctcctcgtcttccccgtctcagcaacctacgagtcccaccgcctcgccgaggac
gctctgctcgacgactacaagggccacggcgacggcgcccccgtcgtctggttccgccag
accatccgcaacgcctgcggcctcatgggcctcctgcacgccgtggccaacgggccggcg
cgggactacatcgaggcctcctccgacctcgacaccctcctccagcaagccttgcccctg
caccccgccgagcgcgccgccctgctggagaagagcacggcgctcgccaacgcgcaccgc
agcgccgcgtcacagggcgacacgtcggcgcccgaggccacggatgacgtcgacctgcac
tacgtctgctttgtcaagacgacggacggggcgttctgggagctcgacggacggagaaag
ggcccgttgcagcggggccaactcgaggagagcgaagatgtcttgagcacgaaggcgctg
acgctgggcccgctcaagttcctcgagcgggagggtgctgatttgcggttcagtgccgtt
gcactggcgggggctactgactag

DBGET integrated database retrieval system