KEGG   Verticillium alfalfae: VDBG_08312Help
Entry
VDBG_08312        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VDBG_08312
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   VDBG_08312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MATPNPDPPSTAPAFIPLEANPQLMTTLLHKLGLSSALQIHDVYSLTDPDLLAFIPRPAL
ALLLVFPVSATYESHRLAEDALLDDYKGHGDGAPVVWFRQTIRNACGLMGLLHAVANGPA
RDYIEASSDLDTLLQQALPLHPAERAALLEKSTALANAHRSAASQGDTSAPEATDDVDLH
YVCFVKTTDGAFWELDGRRKGPLQRGQLEESEDVLSTKALTLGPLKFLEREGADLRFSAV
ALAGATD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgaaccccgacccgccgtcgacagccccggccttcatccccctcgaggcg
aaccctcaactcatgaccaccctcctccacaagctcggcctctcctccgccctccagatc
cacgacgtctactccctcacagaccccgacctcctcgccttcatcccccgccccgcgctc
gccctgctcctcgtcttccccgtctcagcaacctacgagtcccaccgcctcgccgaggac
gctctgctcgacgactacaagggccacggcgacggcgcccccgtcgtctggttccgccag
accatccgcaacgcctgcggcctcatgggcctcctgcacgccgtggccaacgggccggcg
cgggactacatcgaggcctcctccgacctcgacaccctcctccagcaagccttgcccctg
caccccgccgagcgcgccgccctgctggagaagagcacggcgctcgccaacgcgcaccgc
agcgccgcgtcacagggcgacacgtcggcgcccgaggccacggatgacgtcgacctgcac
tacgtctgctttgtcaagacgacggacggggcgttctgggagctcgacggacggagaaag
ggcccgttgcagcggggccaactcgaggagagcgaagatgtcttgagcacgaaggcgctg
acgctgggcccgctcaagttcctcgagcgggagggtgctgatttgcggttcagtgccgtt
gcactggcgggggctactgactag

DBGET integrated database retrieval system