KEGG   Verticillium alfalfae: VDBG_08416Help
Entry
VDBG_08416        CDS       T02227                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
val  Verticillium alfalfae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VDBG_08416
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VDBG_08416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 305 aa AA seqDB search
MTASGFESGCGGKGANQAVACAKLSRSRTLEDPSVDVFMIGAVGGDSAGSGLIESLDSCG
VDTSMVRVNASGGEDSQTGIAIIIIDESDGQNRIILSPGANRSVGFDHVQQSVSLKPDLL
ILQMEVPAPTVLESIQAAKAAKVPVLLNQAPAISLPAEAYQGLDHLILNETEAALVADVA
ESELEDPSSLATVADQLLQKGVKNVILTLGARGVFYACESGERRLVPALKVDAIDTTAAG
DTFIGAYAVAFAEETSRGEDFEIEDAVARAIRGSSITVSRRGAQTSIPWRNELKGLEFKY
QELEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctcgggcttcgaatcaggctgcggaggcaagggggcaaaccaagccgtcgct
tgtgccaagttgtcacgaagtaggactcttgaagaccccagtgttgatgttttcatgatc
ggggctgtaggaggagatagcgccgggtccgggctcatcgagagtcttgactcgtgcgga
gtggacaccagcatggttcgggtcaatgcctctggcggcgaagactctcaaaccggcatc
gccatcatcatcatcgatgaatcggacggccaaaacaggatcattttgtctcccggcgcg
aaccgctccgttggttttgaccacgtccagcaatctgttagcctcaagccagacctcctg
attcttcagatggaagttcccgcgcccactgttctcgaaagcatccaggctgccaaggct
gcgaaggttcctgttcttctgaaccaggcgcctgccatttcattgccggctgaggcatat
cagggattggatcatctgattctgaatgaaaccgaggctgcgctcgtcgctgacgtggcg
gaatctgagctcgaagatccctcgtcactggctaccgttgctgatcaactcttgcaaaag
ggcgtcaaaaacgttattcttacactaggtgcccgcggtgtgttttatgcttgtgaaagt
ggcgagaggcggctggtgccggccctcaaggtcgatgccatagatacgacggcggctggg
gacacgttcatcggagcttacgctgtggcttttgcagaggaaacttcacgaggtgaggat
ttcgagatcgaggacgctgttgcgcgagctatcaggggatcgagcatcactgtctctcgt
cggggagctcagacgtcaatcccctggaggaacgagttgaagggattggagtttaaatac
caagaactcgaactctga

DBGET integrated database retrieval system