KEGG   Verticillium alfalfae: VDBG_08619Help
Entry
VDBG_08619        CDS       T02227                                 

Definition
catechol O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
val  Verticillium alfalfae
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    VDBG_08619
Enzymes [BR:val01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     VDBG_08619
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VDBG_08619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 271 aa AA seqDB search
MAVFDSSKAYAEQEDVYFNDGREVELQRYVCSHPSLERLKGSPQEVLAAIDEFGRQRKYL
MNIGSEKGAIVADLIASLKPKIMVELGGYVGYSAVLFADAMRNAGGERFICIEKNPDFAA
VARSMVELAGLSSIVEIHVGSADVTLKRLHSSGILESIDLLFLDHIKPAYLPDLKTCESL
RLVRPGSVLAADNVIKPGNPPYLEYVRSTVEDKQQAARNRMMEDAAARGDPSLIYQSELI
HSFEPTGIPVSLFYLVLWKLAHLRTFRMVWR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccgttttcgattcctccaaggcctatgccgagcaagaggacgtatatttcaacgat
ggacgcgaggtcgagcttcagcgctacgtgtgttctcacccgagtcttgagagattgaaa
ggatcgcctcaggaggttctggcagccatcgacgaatttggcaggcagcgtaagtatctt
atgaacattgggtctgagaaaggcgccatcgttgccgacttgatcgccagcctgaagccg
aaaataatggtcgaacttggaggctatgtaggctattcggcagtcttatttgccgatgcc
atgcgtaacgcaggtggggagcgtttcatttgcatcgagaagaatcccgattttgccgct
gtcgcaaggtccatggtcgagctggcagggttgagctccatcgtggaaatccatgttggc
tcggcagatgttactctcaagagactgcattccagtggcattctggaatccatcgatctc
ttatttctggatcacattaagccagcttacctcccggatttgaagacctgcgaaagcttg
cgtttggtccgccctggcagcgtactggccgcggacaacgtcatcaagccgggcaacccg
ccatacctagagtatgtgaggagcacagtggaagacaagcaacaagcggcgcgcaacaga
atgatggaggacgctgcggcacgtggtgatcctagtctcatataccagagtgagctcatc
catagctttgagcctactggaatacctgtgagtctattttaccttgtactatggaaactg
gctcatttgcggacttttaggatggtgtggagataa

DBGET integrated database retrieval system