KEGG   Verticillium albo-atrum: VDBG_08619Help
Entry
VDBG_08619        CDS       T02227                                 

Definition
catechol O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
val  Verticillium albo-atrum
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:val00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 271 aa AA seqDB search
MAVFDSSKAYAEQEDVYFNDGREVELQRYVCSHPSLERLKGSPQEVLAAIDEFGRQRKYL
MNIGSEKGAIVADLIASLKPKIMVELGGYVGYSAVLFADAMRNAGGERFICIEKNPDFAA
VARSMVELAGLSSIVEIHVGSADVTLKRLHSSGILESIDLLFLDHIKPAYLPDLKTCESL
RLVRPGSVLAADNVIKPGNPPYLEYVRSTVEDKQQAARNRMMEDAAARGDPSLIYQSELI
HSFEPTGIPVSLFYLVLWKLAHLRTFRMVWR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggccgttttcgattcctccaaggcctatgccgagcaagaggacgtatatttcaacgat
ggacgcgaggtcgagcttcagcgctacgtgtgttctcacccgagtcttgagagattgaaa
ggatcgcctcaggaggttctggcagccatcgacgaatttggcaggcagcgtaagtatctt
atgaacattgggtctgagaaaggcgccatcgttgccgacttgatcgccagcctgaagccg
aaaataatggtcgaacttggaggctatgtaggctattcggcagtcttatttgccgatgcc
atgcgtaacgcaggtggggagcgtttcatttgcatcgagaagaatcccgattttgccgct
gtcgcaaggtccatggtcgagctggcagggttgagctccatcgtggaaatccatgttggc
tcggcagatgttactctcaagagactgcattccagtggcattctggaatccatcgatctc
ttatttctggatcacattaagccagcttacctcccggatttgaagacctgcgaaagcttg
cgtttggtccgccctggcagcgtactggccgcggacaacgtcatcaagccgggcaacccg
ccatacctagagtatgtgaggagcacagtggaagacaagcaacaagcggcgcgcaacaga
atgatggaggacgctgcggcacgtggtgatcctagtctcatataccagagtgagctcatc
catagctttgagcctactggaatacctgtgagtctattttaccttgtactatggaaactg
gctcatttgcggacttttaggatggtgtggagataa

DBGET integrated database retrieval system