KEGG   Verticillium alfalfae: VDBG_08693Help
Entry
VDBG_08693        CDS       T02227                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VDBG_08693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 479 aa AA seqDB search
MAEEGECTSANANDALNIGLVRPTDAGLKAIATFNPRFTYPIFGNEEQIFGYKGLKINLR
YSANDMRPHVQITSKEKFKAIGDTEPTDIKAVLQEHLPAIAFSSVKDFEASVQKTTEEWK
PSGELHTSFETQDGTYEIRKGSLTDPAIHQLITRVEIFVPLFIEGGSYIARDPEAADPWK
VPDDAARWTVFLLYRKQPVADDAAQSPYTFVGYSTIYRFFYFQAPSPPASPAADWELPKG
DFEITDLPCRTRLSQFVILPPFQGKGIGARLYKSIFEYYLANPLAMELTVEDPNEAFDDM
RDLSDLTYLKTVPEFAQVRINTDINVPDDSSKAVPRDIVDSDLLDKLRRKTKIAPRQFAR
LIEMHTMSQLPASVQPSFGVDKKAKPTRAEAHQYRLWRMFAKQRVYRQNKDILGQIDLPE
RREKLNEALGSVELEYARLLAAHERWEKHYGPSSSNGKRKSVDEAEGQGLSKKARVEDA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagggtgaatgtacgtcggcgaatgccaacgacgccctgaacatcggcctc
gtcaggccgaccgatgcgggcctcaaagcgatcgccacgttcaatccgagattcacatat
cccatctttggcaatgaggagcagatctttggctacaaggggctcaagatcaaccttcgg
tactccgccaacgatatgcgccctcacgtccagatcacgtcgaaagagaaattcaaggct
ataggcgacactgagccaacagacatcaaggctgttctgcaggagcatctgccagcaatt
gccttctccagtgtcaaggatttcgaggccagtgtgcagaagactacggaagaatggaag
ccatctggagagctccacacgagcttcgagacacaggatggaacatacgagatccgcaaa
ggcagcctcacggatcctgccattcatcagctgatcactcgagtcgagattttcgtacca
ctcttcatcgagggcggctcctatatcgcccgggaccccgaggcggcagacccgtggaag
gtgccggacgatgccgcccggtggaccgtcttcctgctgtacaggaaacaacctgtcgcc
gacgatgcggctcaatcaccgtacacctttgtgggatactccaccatataccgattcttc
tacttccaggcgccctcacctccggcgtctcctgcggccgactgggagcttcccaagggc
gatttcgagatcactgatctcccctgccgaactcgtctgtcgcagtttgtcatcctgccg
cccttccagggcaagggcattggcgccagactctacaagagcatattcgagtactacctt
gccaaccccctggccatggagctcactgtcgaggaccccaatgaggctttcgatgacatg
cgagacctttcggacctcacatatctgaaaaccgttcccgaattcgcccaggtccgcatc
aacactgacatcaacgtgcccgacgactcgtccaaggcggtgcctcgtgacattgtcgat
tcggaccttctcgacaagttgcgccgcaaaaccaagatcgccccgcggcaatttgcccgg
ttgatcgaaatgcataccatgtcacaacttcctgcatccgtgcagcccagtttcggtgtc
gataaaaaagctaagcctacgcgagccgaggcacaccagtatcgcctctggcgcatgttt
gccaagcagcgtgtgtatcgtcaaaacaaagatatcctcggtcagatcgatcttcccgag
cgtcgcgaaaagctgaacgaggccctgggcagcgttgagctggagtacgcgcgacttctg
gcggcgcatgagaggtgggagaagcactatggcccgagctcttccaacgggaagaggaaa
tcggtggacgaggcagagggccaggggttgagcaaaaaagctcgtgtggaggatgcctag

DBGET integrated database retrieval system