KEGG   Verticillium alfalfae: VDBG_08701Help
Entry
VDBG_08701        CDS       T02227                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
val  Verticillium alfalfae
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VDBG_08701
Enzymes [BR:val01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VDBG_08701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 348 aa AA seqDB search
MKGSSITSICLWLLSASLSTACAHDHDDAKVWSKEELEELERKWGFEWSFTGIGSFAHLK
YTKCLTTPSELYDIAIIGVPFDTAVSYRPGARFGPRAIRQASARQTSFRGSSMRRPKLMT
LGGDHSLALPALRALREIYGQPIRVLHFDAHLDTWHPSKYPSAWAPTPFNHGSMFWLAGT
EGLLSNATTGPSVHAGLRTRLSGTDASDHDDDTAQNWVRISADEMDDFGTAGVITRIMET
LGTEDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGVEGLNVVGADVVEVSPA
YQGSWGRDGARGGAGRLRGPELHGQEGTWRDGSRERGAGGCDSGRSQG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctcgtccatcacatccatctgcctctggctactgagcgcctcgctgtcgacg
gcgtgtgcccacgaccacgatgacgccaaggtgtggtccaaggaggagctggaggagctg
gagcgcaagtgggggttcgagtggtccttcaccggcatcggttccttcgcccatctcaag
tacacaaagtgcttgacgacgccctcggagctctacgatatcgccatcatcggcgtcccc
tttgacacggccgtcagctaccggcccggcgcccgcttcggcccccgcgccatccgccag
gcctcggcgcgccagacctccttccggggctcttccatgaggcggccaaagctcatgacg
ctcggcggagatcacagtctcgctctgccggcgctgagggccctcagggagatttacggg
cagccgatccgggtgcttcactttgacgctcacctcgacacgtggcacccctccaagtac
ccctcagcctgggcgccgacgcccttcaaccacggctccatgttctggctcgccggcacc
gagggcctgctgtcgaacgcgacgacggggccctcggtgcacgcgggcttgcgcacgcgt
ctcagtggcaccgacgcgtcggaccacgacgatgacacggcgcagaactgggtgcgcatc
tcggcggacgagatggatgatttcggcacagccggcgtcataacgcgcatcatggagacg
ctcggcaccgaagaccccgtctacctgtccgtcgacattgacgtgctcgacccggccttt
gcgccgggtacagggacgcccgagcccggcggctggaccacgcgcgagctgatccgcgtg
ctgcgcggcgtcgagggcctcaacgtcgtcggagccgacgtcgtcgaggtgtcgcctgct
tatcaggggagctggggaagagacggcgctcgcggcggcgcaggtcgtctacgaggtcct
gagctccatggtcaagaggggacttggcgagatgggtcgcgagagcgaggtgcaggggga
tgcgattcaggaagatctcaaggatga

DBGET integrated database retrieval system