KEGG   Verticillium alfalfae: VDBG_08737Help
Entry
VDBG_08737        CDS       T02227                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
val  Verticillium alfalfae
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VDBG_08737
   00650 Butanoate metabolism
    VDBG_08737
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VDBG_08737
   00280 Valine, leucine and isoleucine degradation
    VDBG_08737
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VDBG_08737
Enzymes [BR:val01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     VDBG_08737
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     VDBG_08737
Amino acid related enzymes [BR:val01007]
 Aminotransferase (transaminase)
  Class III
   VDBG_08737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 316 aa AA seqDB search
MAALRASSLLRPATRAARNPAVSRLPARAFSVSFARAASSLFPEEPARPTVKTEIPGPVS
KKYIEDLHEVFDTRSLNMLTDYTKSIGKLHRRPRRQRPPRCLRQNRPPFPWATKNPAPHR
RPPRPPDIGQRPSSTGPALGNFPLPRLGLDPALRHPQGRPPPASTRSSPPWLAPDANETA
YKAAFMYRRQQERGGPNFNTWMGDPARALLFRAILSEVRAHDLVERTAQVGAHLFAGLER
LAAKYPDQVANLRGKDRGTFIAFDSPRRDEVLKTAKTLGVNIGGSGASAVRLRPMLVFEE
SHADILLETLETIVSS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctgcgagcgtcgtccttgctgcgcccggccactcgtgccgcgaggaacccc
gctgtctccagactccctgctcgagccttctccgtctccttcgcccgcgccgcatcgtcc
ttgttccccgaggagcctgctcgtcccacggtcaagacagagattccagggcccgtgtcc
aagaagtacattgaggacctccatgaggtctttgacacgcgcagcttgaacatgctgacc
gactacaccaagagcatcggcaaactacatcgccgaccccgacggcaacgtcctcctcga
tgtctacgccaaaatcgccctccattcccctgggctacaaaaaaccctgcccctcatcgc
cggccgccaagaccccccgacattggtcaacggccatcgtcaaccgggcccgccctcggc
aacttccccctcccacgactgggcctcgatcctgcgctccggcatcctcaaggccgcccc
cccccggcctcaaccaggtcttcaccgccatggctggctcccgacgccaacgagacggca
tacaaggctgctttcatgtaccgccgccagcaggagcgtggtggccccaacttcaacacg
tggatgggcgaccccgcccgcgccctcctcttccgcgccatcctgtccgaggtccgcgcc
cacgacctcgtcgagcgcaccgcccaggtcggcgcccacctctttgccggcctcgagcgt
ctcgccgccaagtaccccgaccaggtcgccaacctgcgcggcaaggaccgcggcaccttc
atcgccttcgacagcccgcgccgcgacgaggtgctcaagacggccaagacgctcggcgtc
aacattggcggctcgggcgcgagcgccgtgcggttgaggcccatgctggtgtttgaggag
agccatgcggatatcctgctggagacactggagacgattgtgtcttcttga

DBGET integrated database retrieval system