KEGG   Verticillium albo-atrum: VDBG_08817Help
Entry
VDBG_08817        CDS       T02227                                 

Definition
cAMP-dependent protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
val  Verticillium albo-atrum
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:val04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 442 aa AA seqDB search
MPSLNLSGLLKKKRTRDNNQEPQTSSQPNSPVTPTNAARKSSSIPVASVVASSPSASASA
NSQVNPQQPQQQPQQQQHQLAPSSEADNLSPGMYPVSVHPANHQNSPHAALHHNPLQSDS
QKSLPSISNLINPPQQHDGSNQQSNTFLTQPASHIQPSASPGTDPERLQQQQAQSMMHPP
QQQLHNHQHQLQQHGQDQGQARQTKGKYTLTDFDLLRTLGTGSFGRVHLVQSKHNQRFYA
VKVLKKAQVVKMKQVEHTNDERRMLGEVKHPFLITLWGTFQDSKNLYMVMDFVEGGELFS
LLRKSGRFPNPVAKFYAAEVTLALEYMHEKDIIYRDLKPENLLLDRHGHLKITDFGFAKK
VPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILVYEMLCGYTPFWDSGSPMKIYEN
ILRGKVKYPQYMDPSARTSWRS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccttccctcaatctctccgggctactcaagaagaagcggacacgagacaacaatcag
gagccacaaacctcgagccagcccaacagccccgtcacccccaccaacgccgcgcgcaag
tcgagctccattcctgttgcctctgtcgttgcctcttcgccgtcagcgtctgcctcggcc
aattcgcaggtgaatccccagcagccgcaacagcagccgcaacagcagcagcatcaattg
gcgccttcttctgaggccgacaacctgtcgccgggcatgtatcccgtatctgttcacccg
gcaaatcaccaaaacagccctcacgcggctcttcaccacaaccctctgcaatccgactcg
caaaaaagcctaccgagtatcagtaacctcatcaacccccctcaacagcatgacggttcg
aatcagcagtccaacacattcctaacccaacctgcatctcacattcaaccctcggccagt
cctggcaccgaccccgaacgcctacaacagcaacaagcccaatccatgatgcatccccca
caacagcaactacacaaccaccagcatcaattgcaacaacatggccaagaccaaggccag
gctcgccagaccaagggcaaatacaccctcactgatttcgacttgctacgcaccctcggc
accggcagcttcggccgtgtacaccttgtccagtctaaacacaaccaacgcttctacgcc
gtcaaggttctcaagaaggcgcaggtcgtcaagatgaagcaggtcgagcacacgaacgat
gagcggcgcatgctcggcgaggtcaagcatccattcctgataaccctgtggggcactttc
caggactccaagaacttatacatggtcatggactttgtcgagggcggcgagctgttctcg
ttgcttcgcaaatccggtcgattcccgaaccctgtcgccaaattttatgccgccgaggtc
acgctcgcgctggaatacatgcacgagaaggacataatctaccgagatctgaagccagag
aacctcttgcttgatcgacacggccacctcaagattactgattttggattcgcgaagaag
gtaccggacaagacatggacgctttgcggcacacctgactacctggcgcccgaggtcgta
tcgaacaagggctacaacaagtccgtggactggtggtcactaggtatcctcgtctacgaa
atgctgtgcggctacacgcccttttgggacagcgggtcgccgatgaagatctacgaaaac
atcctgcgcggcaaggtcaagtacccgcagtacatggaccctagcgcgcggacctcttgg
agaagctga

DBGET integrated database retrieval system