KEGG   Verticillium alfalfae: VDBG_08829Help
Entry
VDBG_08829        CDS       T02227                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
val  Verticillium alfalfae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VDBG_08829
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VDBG_08829
Enzymes [BR:val01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VDBG_08829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 428 aa AA seqDB search
MRGIKPLTVVLKLGTSSIVDEETHQPLLSILTLIVETAIKLKKDGHRVIIVSSGAIGVGL
LRMEMDHRPKHLSALQALAAIGQCRLISLWDSLFMHFRQPVAQILLTRNDIADRTRYTNA
QNTMNELLGLGVIPIVNENDTIAVSEIKFGDNDTLSAITAGMVHADMLFLMTDVDFSGAG
SSLGTGGMMTKIIAARLATSVGVTTIVTRSSNPGNILEIVRYEHAARNILQAANIPNQDD
EEGMEEFLAASTASIQLDNLEKPPLHTCFLPSAEPIHDRHFWLLHTLRPNGTIYIDAGAH
SALLRKAGLLPAGVLDVEGSFAQHESVRLVVVDRLHVPSPTGRIWGGNPTEVGRALVNYA
AHEVGRIMGHQSAEIQGLLGYADSEYVAERQHISLFRRESRPQTPSFEVVKEVAETLGAG
ISGYEARV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcatcaagccattgacggttgtcctcaagctgggaaccagctctattgtcgac
gaggaaactcaccagcctcttctgtccatactgacgctcattgttgagacggccatcaag
ctgaagaaggatggccatcgcgtgatcattgtttcttccggcgccatcggcgtcggtctt
cttcgtatggaaatggatcacaggccaaaacacctgtcggcattgcaggccttggcagca
attggccaatgcaggctcattagcctctgggacagtctgtttatgcacttcaggcaaccg
gtggcacaaatccttctcacgaggaatgacattgccgatcggacaagatacaccaatgcg
caaaacacgatgaatgagctgctcggccttggtgtcattcccatcgtcaacgagaacgac
accattgccgtgtcagaaatcaagtttggcgacaatgacacgctatccgctatcactgcc
ggcatggtccatgccgatatgttgttcctcatgaccgatgtcgacttttccggtgccggt
tcctcgctcggtaccggcggcatgatgaccaaaatcatcgccgcccgcctcgcaacctct
gttggcgtcacaactattgtcactcgctcttcaaatcctggcaacatccttgagatcgtc
cggtacgaacacgctgctcgaaatattctgcaagccgccaacatccccaaccaagacgac
gaagagggtatggaggagttcctcgccgcctccacagcctccatccagctcgacaatctc
gagaagcctccgctacacacctgcttcctgccgtccgcagagcccatccacgatcgccac
ttctggctcctccacacactgcgtcccaacggcacgatttacatcgatgcaggggcccac
agtgccctccttcgcaaggcaggtctccttcccgcaggtgtccttgacgtagagggcagc
tttgcccaacatgagtcagtccgcctcgtcgtcgtggaccgtcttcacgtcccctcccct
acaggtcgcatctggggcggcaaccccaccgaggtcggccgtgccctggtcaattacgcg
gcgcacgaggtcggtcgtatcatgggccatcagagcgccgagattcagggcctccttggc
tatgccgacagcgagtacgtggctgaacgccagcacatcagtctcttcaggcgggagagc
cggccccagacgccgagtttcgaggtcgttaaggaggttgccgagactctgggcgcgggc
atctcagggtacgaggcacgagtgtag

DBGET integrated database retrieval system