KEGG   Verticillium alfalfae: VDBG_09023Help
Entry
VDBG_09023        CDS       T02227                                 

Definition
cyclin CCL1
Orthology
K06634  
cyclin H
Organism
val  Verticillium alfalfae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    VDBG_09023
  Replication and repair
   03420 Nucleotide excision repair
    VDBG_09023
Transcription machinery [BR:val03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     VDBG_09023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 365 aa AA seqDB search
MATEDARYRLSSQFRLWSYPSPNLADLREKTNALAAQQISTRLRETKPEDLLPEFLTAAE
ETVLLKFFTVELIRAAIFCDLPTEIRATAAVFLRRFYITNSVMTYPPTDLLKTCLFFGGK
AEGYFAKLSKLADKFPNTTEEEILAGEFLLCQGIRFAFDVRHPFRGLEGTILELRRHSDI
KTSRIDAAHQRAREILKFSSLVTDAYFHYTPSQIMLAALSLADEGLCDTILDNTFAKASG
DALEVKVKLTATVRACKDLLSTELPERMQDYWGTFANSIKPESMKLIRPLVKKLKKCRDP
DRADLVALQKARREAAATATAKEKEVRKGSKPGLDGGALGMPLGGLDRDTKRRKVTGDDV
FGGAL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagaagatgcgcgctaccggctgtccagccagtttcgcctctggtcttatccg
tcacccaacctggccgaccttcgcgagaagacaaacgcgctcgccgcgcaacagatcagc
acacgcctacgcgaaacgaagcccgaagatctgctgcctgagttcctgactgccgccgaa
gaaactgtactgctcaagttttttacggtcgaattgatccgcgcggccatcttttgcgac
ctgccgaccgagatacgcgccactgctgccgttttcctgaggagattctacataacgaat
tccgtcatgacgtatccgccgacggatttgttgaagacgtgtttgttctttgggggcaag
gccgaggggtactttgcaaagctgtcgaagctggcagacaagtttcctaacacgacagag
gaggagattctcgccggcgagttcctcctgtgtcagggcattcggttcgcttttgacgtg
cgacatcctttccgcgggctcgagggcacaattcttgaattgaggcggcacagcgacatc
aagacctcccgaatcgatgctgcccatcagagagcacgcgagattctcaagtttagctct
cttgtcaccgacgcctacttccactacacaccgagtcaaatcatgctggcagctctctcg
ctcgcagacgaagggctgtgcgatacgatcctcgataatacatttgcaaaagcgtctggc
gatgccttggaggttaaggtcaagctcacggcaacggtccgtgcctgcaaggatctgctg
tccacagagctacccgaaagaatgcaggactactggggaacgttcgctaacagtatcaag
cccgagagcatgaaattgatacgaccgttggtcaagaaactcaagaagtgcagggaccct
gatcgcgcagatctcgtcgccctgcagaaggcgaggcgggaagcagccgccacggcgacg
gcaaaggagaaggaggtgcgcaagggaagcaagcctgggctggatgggggcgcacttggc
atgcccctcggaggacttgacagggacacgaaacggaggaaagtgaccggagacgatgtc
ttcgggggcgctctgtga

DBGET integrated database retrieval system