KEGG   Verticillium alfalfae: VDBG_09222Help
Entry
VDBG_09222        CDS       T02227                                 

Definition
RNA polymerase II transcription factor B subunit 2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
val  Verticillium alfalfae
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:val00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    VDBG_09222
  Replication and repair
   03420 Nucleotide excision repair
    VDBG_09222
Transcription machinery [BR:val03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     VDBG_09222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 476 aa AA seqDB search
MSAGLTKSLQLADYLEKLPGTTFRKLYLNPSTALCISRRMLSPLAKTFVTMLLYLPGPIP
IADLEARVKPEYKRAKDHALAQLRSLHMLQMSVPTQGAPQMIQLTANFSKSYREALEGNG
APGSFGVISPHPRSPEITIESIEKHARQKWDAILHYIVNSVTPGFVDSGGPKNSVKELLL
AGQLVKRQGGSTTITQAGFTFLLQEENAQVWTLLLLWLDATDQQTAKHTDMLSFLFQLSI
LELDEVYDTEALSKERQDMLPSLMDFGLVYIPSHKPFQYFVTPQARALTNVSTATRTLTD
GMNALSQSQGGPGDQTNGIIVETNYRVYAYTTSQLQIAVLSLFCHLSVKFPGMVSGRLTR
QSVRQAIDFGITADQIISYLAAHAHEQMHRQAAADGKPVLPPTVVDQIRLWQLENERMKT
TSGFLFRDFDDDAEYRDIARFADEIGVLAWRNDRKRMFFASKHEQIRDYLKLRKKA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcttgacgaagtcgctccagctggccgactacctggagaagctgcccggt
acaacgtttagaaagctgtacctgaacccctccacggcattatgcatctcaagacgcatg
ttgtcgccactggccaagacatttgtgacaatgctcctataccttcccggaccgatacca
atagcagacctcgaggcgcgcgtgaagcccgagtacaagagagccaaagatcatgctctc
gcacaactccgaagtctacacatgttacagatgtctgttccaacacaaggcgctccgcaa
atgatacagctcacggccaacttttcgaagtcctaccgcgaggccctcgaaggcaacgga
gcaccaggctccttcggcgtgatctctccgcacccgcgctcacccgaaatcacgattgag
tcgatcgagaaacacgcacgccagaaatgggacgccattttacactacattgtcaacagc
gtgacgcccggcttcgtcgacagcggcggtcctaagaactccgtcaaggagcttctcctc
gcgggccagctcgtcaagcgccaaggcggcagcaccacaatcacgcaggctggcttcaca
tttttgctgcaagaagaaaacgcgcaggtctggacgctgctgttgttgtggctcgacgcg
accgaccagcaaacggccaagcatacggatatgctctctttcctgttccagctctcgatc
cttgagctcgacgaggtctacgacaccgaagccctcagcaaagagcgccaagacatgctt
ccgagcctcatggactttggcctagtctacataccctcccacaaacccttccagtacttt
gtcacgccccaagcacgcgccctcactaacgtatcgacggcgacgcgcaccctgaccgat
ggtatgaacgccctgtctcaatcccagggcggaccaggcgaccagacgaacggcatcatc
gtcgagaccaattaccgagtctacgcgtacacaacgtcgcagctgcagatcgccgttctc
tccctcttctgccacctctccgtcaagttcccaggcatggtctcgggtcgtctgactcgc
cagtccgtccgccaggccatcgactttggcatcacagccgaccagatcatctcctacctc
gccgcccacgcccacgagcagatgcacaggcaggccgccgccgacggcaagcccgtcctc
ccgcccaccgtcgtcgaccagatccgcctctggcaactcgagaacgagcgcatgaagacg
acgtctggcttcctcttccgcgactttgacgacgatgccgagtacagggatatcgcgcgg
ttcgccgacgagattggcgtgctggcgtggcggaacgatcggaagcgcatgttcttcgcg
agcaagcatgagcagatccgcgattatctcaagctgcggaagaaggcgtag

DBGET integrated database retrieval system