KEGG   Verticillium albo-atrum: VDBG_09310Help
Entry
VDBG_09310        CDS       T02227                                 

Definition
histone acetyltransferase mst2
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
val  Verticillium albo-atrum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 973 aa AA seqDB search
MASAQLAAEEELQQSVVVSEEDLERDESDSSNAAMLPYQNQDDTSEPSRTGSGKQSYLHV
NGLEDSTIERPGGPTATLVSKNAESIEDDAEGEEDAPGEDDGAADADEIVDPYYDEDDAE
GEEDVEHVVQLNMDQDDGVGEAVEQSTESVQSGEDEEDNDDEGVGAVKIRPGDTDDEDDD
VDSEQSHSTTDGSEDSDGAAAWEDAPESHEDEDEESGAAGRTLCLFCKQDEEHDPGEDFE
DYLMCSHCGENCAFDTKDETLHTDIFQHINFAREKPVLCDRTMTSDSHIHDDQDVLDKQE
YPDVDGDDDEHARLLRKRRTSLSEPDDSAMLLRKRRRRTPEEQHSSRETTSHNAQSEAGE
TDKPRKLRLKVSRNHAAVTITRRSNSMLISIRVNPAGLRHIMVSKASSNRKRTARNEPAR
SVRPSLTALSTPFMSSSSSQPFYSFLDRETDDIRTKPYGGILTDVEADTSRTLPTNDDRR
RFDEAKQKAEEEWRTMHVIQISREGAEKAKKGKKAAGPASQIECIEFGGWEIDTWYAAPY
PEEYSRNRILYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRHGSISVFEVDGRKNP
VYCQNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYDDLGYHFVGYFSKEKRASSQNNVSCI
LTLPIHQRKGYGNLLIDFSYLLTRVEKKTGSPEKPLSDMGLVSEYVSKWDAKQYVKLHEE
ALVWTPYVMGRGNTTNFELGPAITAMAPREEEEDRKIVAPPLVNAVSTGVALESQGSVLV
PAEIGPAPEKLTPVDGVADEQSALADQVYTPAGGRRQERPRASFPRPAIVRTAPLSSSSS
AKPRRSAGGGSVKRPSASKPKTSGTSRRKSGGTGRGPGRWPKGTKKSDYGNADSGPGLPP
AWVQERQRLLAESAKKKGTGAAAHEATGGEAARVQFEDLVALHGDARVPGAAAPGGDIAY
TNIASDIPAVGDE
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgcccagctagcagctgaagaggagctgcaacaaagcgttgtggtttctgag
gaggacctggagcgcgatgaatcggactcctcgaacgcggcaatgttaccttatcaaaat
caggacgatacatcggaaccctcgagaactgggtccggtaagcagtcatacctgcacgtc
aatggcttggaagactcgacaatcgaaagacccggcggtcctacagcgaccttggtctct
aagaatgctgagtctatcgaagatgatgcggaaggagaggaggacgccccgggcgaagat
gacggcgctgcagatgccgacgaaattgtggacccctactacgatgaggacgatgctgaa
ggggaggaagatgtcgagcatgttgtgcagctcaacatggatcaagatgacggcgtcggc
gaagcagttgaacagtccacagagagtgtgcaatctggtgaagatgaggaagacaacgat
gacgaaggcgttggcgctgtgaaaatccggcctggcgacaccgacgacgaagatgatgat
gtcgatagcgaacaatcacattcaactaccgatggctcggaagactcggacggcgcagct
gcctgggaggatgccccagaaagtcacgaagatgaggatgaagagtcaggtgctgcaggt
cgaactttgtgcttgttctgcaaacaggatgaagaacatgacccgggcgaagactttgag
gactacctaatgtgctctcattgtggcgagaactgtgcgtttgacaccaaagacgagact
ctgcatactgacattttccagcacatcaattttgcgcgcgagaaaccggtgctttgcgat
cgcacgatgacatctgattcgcatatacacgatgatcaagacgttttggacaagcaagaa
tatcccgatgtggatggcgatgacgatgaacatgcacgacttcttcgaaaacgccgaact
tctctctctgaacccgacgacagtgcaatgttgcttcgtaagcgtcggcggcgcacgcct
gaagaacaacattcgtcgcgtgaaaccacgtctcacaacgctcaaagcgaggctggtgag
acagacaaacctcgaaagttgcgcctcaaggtgtctcggaatcatgccgccgtcactatc
accaggcggtcgaatagcatgctgattagcatccgtgtaaaccctgccggcttacgacat
atcatggtgtccaaagcatcttcaaatcgtaaacggacggcaaggaacgagccggcgcga
tcagttcgaccgagcctcacagcgctgtcgacgccattcatgtcatcaagtagctctcag
ccattctactccttccttgatcgagagacggacgatataagaacaaagccctatggcggc
attcttactgacgtcgaagctgacacgtctcgcacgttacccacgaatgatgaccgcaga
cgctttgacgaagccaagcaaaaggctgaggaagaatggaggactatgcacgtcatccag
atcagccgcgaaggcgctgaaaaggccaagaagggtaaaaaagcggctggtccggctagc
caaatcgagtgcatcgagtttggcggttgggaaatcgacacgtggtatgcagcaccctac
cccgaggagtacagcaggaatcggattctgtacatctgcgaattctgcctcaagtacatg
aactctgactacgtggcatggcgccataagctcaagtgcccggctaaacaccctcccgga
gacgagatctacaggcacgggtccatttctgtgtttgaggtggatgggcgcaagaacccg
gtctattgtcagaacctctgtctgctcgcaaaattattcctcggctcgaagaccctctac
tacgacgttgagccctttctgttctacgtactttgcgagtacgatgatctgggctaccac
tttgtcgggtatttttcgaaagaaaagcgagccagcagccagaacaatgtgtcttgcatc
ttgacactgccgatccaccagcgcaagggctacggcaaccttctgattgacttctcctac
ctattgacacgcgtagagaaaaaaaccggctctccggagaagccgttatctgacatgggt
cttgtctcagagtacgtgtcgaagtgggatgctaagcagtacgtcaaactccacgaagag
gctctggtctggacgccttacgtgatggggagaggaaacacgacaaattttgagctgggc
cctgccatcactgccatggctccccgggaagaggaggaagaccgcaagatagtcgcgccg
ccacttgttaatgccgtttcaacgggcgtggctttggagagtcagggctcggttctcgtg
cctgcggagatcggtccagcacccgagaagcttactccagtagatggtgtagcagatgaa
cagagcgccttagcggaccaggtctacacgccagccggtgggcggcgccaggaacgccca
cgggcctcgtttccgcgccctgcaattgtccgcacggctccactcagcagcagcagcagc
gccaaacccagacggtcagcgggtggcggcagcgtcaagcggccatctgcgagcaagccc
aagacgagcgggacctcgcgccgcaagagcggtggcactggccgcggcccaggccgttgg
cccaagggcacaaagaagagcgactatggcaacgccgacagcggcccaggcctgccgccg
gcatgggtgcaggagcgccagaggctcctcgctgagagcgccaagaagaagggaaccggc
gcggctgcgcacgaggcgaccggcggggaagctgcccgggtccagtttgaggatctggtg
gcgttgcatggtgacgccagggtgcccggggcggcggcacctggtggtgacattgcttac
accaacattgcgagtgatatcccggctgttggagacgagtag

DBGET integrated database retrieval system