KEGG   Verticillium albo-atrum: VDBG_09377Help
Entry
VDBG_09377        CDS       T02227                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
val  Verticillium albo-atrum
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VDBG_09377
Peptidases [BR:val01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   VDBG_09377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 318 aa AA seqDB search
MSGGWNTIESDAGVFTYLLENLGVKGVQFEELLTLSPDDLAPLQPVYGIIFLFRYPSEGL
PPRPKESYDEDAAESLFFARQTIQNACGTQALLSVVMNKNDEVDIGDRLGEFREFAMALP
PEFRGEALSNSELIREVHNSFAKSSPFVDETQRGDEGGEDAFHFVAYSSIGGKLYELDGL
QPAPISHGDCTPEEFPVKISGILSDRVATYASSEIRFNVLAMVRDPRIAAAEIGDQETIA
RESEKRRQWQWENALRRHNFVGFAGEVMKGVVGEKVKAGNGAYEAWIKEGLERRKRDEDA
TRLRRRMGGGDGDEEMIG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgggtggaacacgatcgagtcggacgccggcgtcttcacttatctcctcgag
aatctcggtgtcaaaggggtccagttcgaggagctccttactctctcacctgacgacctt
gctccgcttcagcctgtctatggcatcatcttccttttccgctacccctccgagggcttg
cctccgcgacccaaagagtcctacgacgaggacgccgccgaaagtctattttttgcgcgc
cagaccattcagaacgcctgcggcacccaggcccttctgtcagtggtcatgaacaagaac
gatgaagtcgatatcggtgatcgcctgggcgagttccgtgaattcgccatggccctacca
cccgagttccgcggagaggccctgagcaactcggagctcattcgggaggtccataacagc
ttcgcaaagagcagccctttcgtcgacgagacgcagaggggcgacgagggtggcgaggac
gcgttccactttgtcgcctactcgtctattggaggcaagctgtacgagcttgacggactg
cagccagcacccatctcacatggcgactgcactccggaagaatttcccgtcaagatatca
ggcatcctatcagaccgcgtagccacatatgcgagcagtgagattcgattcaacgtcctg
gctatggtcagggacccgaggatcgctgcggcagagattggagatcaggagacgattgcg
cgcgagtccgagaagaggcggcagtggcagtgggagaatgccctgcgcaggcataacttc
gtgggcttcgccggagaggtcatgaagggggttgttggcgagaaggtcaaggcgggtaat
ggggcctacgaggcgtggatcaaggagggcctggagagaaggaaacgtgacgaagacgcc
acgaggttacggaggaggatgggcggcggagacggagacgaggagatgatcggttaa

DBGET integrated database retrieval system