KEGG   Verticillium alfalfae: VDBG_09518Help
Entry
VDBG_09518        CDS       T02227                                 

Definition
elongator complex protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VDBG_09518
Transfer RNA biogenesis [BR:val03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    VDBG_09518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MTATATHRPKPKTENLAPENERFLRCCADVVNALIEDHEASSDPKKPKRDINLNQLRNKC
AKKHKLANIPSLTAIIAAIPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHRCPHIAYT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKSLGHSVDKV
EYIIMGGTFMSLAESYREDFIAQLHNALSGYQTSNVDEAVEAGEMSNIKCVGITIETRPD
YCLQPHLSDMLRYGCTRLEVGVQSLYEDVARDTNRGHTVAAVAETFCYSKDAGYKVVSHM
MPDLPNCGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTPNEL
IDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTSCRDVRTRE
VGVNEVKHKIRPNQIELVRRDYTANGGWETFLAYEDPKQDILVALLRLRKCSDKYTFREE
LVGQPTSLVRELHVYGTAVPVHARDPKKFQHQGFGTLLMEEAERIARDEHGSTKISVISG
VGVRSYYAKLGYWLDGPYMSKWLDGRPQDKDAR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgacggctacggccacccaccggccaaagcccaagacggaaaaccttgcccccgagaac
gagcgtttcctgcggtgttgcgccgatgtagtcaacgccctgatcgaggatcatgaagcc
tcgagcgacccgaagaagcccaagagggacatcaacctcaaccaactacgaaacaagtgt
gccaagaagcacaagctcgccaacattccctccttgaccgccatcatcgctgccattccc
gaacactacaagaaatacatcctgccgaagctgattgcgaagcctatccgaacatcctca
ggtatcgccgtcgtcgccgtcatgtgcaagccacacaggtgtcctcacattgcctacacc
ggtaacatttgcgtctactgccctggcggccccgactccgatttcgagtacagcacacag
tcctacactgggtacgagcccacgtcaatgcgtgccatccgcgcgcgatacgacccattc
gaacaggcgcgaggccgtgtcgaccagctcaagtctctcggtcactcggtggacaaggtc
gaatacatcatcatgggaggaacattcatgtcgctggccgagtcctaccgcgaggacttc
atcgcgcaactgcacaatgccctcagcggctaccagacgtccaatgtggacgaagccgtg
gaggcgggcgagatgagcaacatcaagtgtgtcggcatcacaatcgagacgaggccggac
tactgcctgcaaccacacctgtcagacatgctgcggtatggttgtacgaggttggaggtg
ggcgtgcagtctctctacgaggacgtggcgcgggacacgaatcgagggcacacagtggcc
gccgtggcagagaccttctgctattccaaggacgccgggtacaaggttgtcagccacatg
atgccggacctgcccaactgcggcatggagcgagacctggaccagttccgggagtatttc
gagaacccagccttccggacggacggcctgaaaatctacccgacgctcgtcatccgcgga
accggcctctacgaattgtggcggacgggacgctaccaaaactacacacccaacgagctc
attgacctcgtcgcgaggatcatggcgctcgtgccgccgtggacgcgcatctaccgtgtg
cagcgcgacatccccatgccgctcgtgacgtcgggcgtggagaacggcaacctgcgcgag
ctggcgctggcgaggatgaaggactttggcacgtcatgtcgcgacgtccggacgcgcgag
gtcggcgtcaacgaggtcaagcacaagatccggccgaaccagattgagctcgtgcggcgc
gactacacggccaacggcgggtgggagacgtttctggcgtacgaggaccccaagcaggac
atactcgtggcgctgctgcggctgcgcaagtgcagcgacaagtacacgttccgcgaagag
ctcgtgggccagccgacgagcctcgtgcgcgagctgcacgtgtacggcacggcggtgccg
gtgcatgcgagggaccccaagaagttccagcaccaaggcttcggcacgctgttgatggag
gaggcggagaggatagcgcgggacgagcacggcagtaccaagatcagcgtcatctcgggt
gtcggtgtcaggagttattatgccaagctggggtactggctggacgggccctacatgagc
aagtggctggatggcaggccacaggacaaggacgccaggtga

DBGET integrated database retrieval system