KEGG   Verticillium alfalfae: VDBG_09523Help
Entry
VDBG_09523        CDS       T02227                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
val  Verticillium alfalfae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VDBG_09523
  Lipid metabolism
   00561 Glycerolipid metabolism
    VDBG_09523
   00600 Sphingolipid metabolism
    VDBG_09523
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    VDBG_09523
Enzymes [BR:val01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VDBG_09523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MLWFYVLATVAPVFGASGSSKRAQKPQMGTCKPHISVRERDFTDLRAGWNSWNTFKLGIN
QTIVEGTAQALVDTGLRDAGYTYLVMDDGWQNLTRGPDGRQQANATRFPSGLKVLADEVH
KKGLKFGLYRLGYGLSEGFYGNTRPLQERFQIMSHALKNTGRDIFYAVCQWGHQWPWYWA
DQFTDSYRMSGDIHAKFRDDGNSVCKTAYCLNTGYAGVSVLTMIRKMREISGFQKKGSWA
DMDMLEVGVNRNFTLHQDQTHLSFWAALKSPLIIGADIRTIRKSSLDVLLKKDIIGINQD
DLGVAVSYVAELSKEDEIQVWAGPVKYKKYNHVVLALNYNVVNHTTDIELPWSKLPGFQG
CKNGNVRVRDVWEDKDLGSQKESISLQEVTQDQTKVLLLFCK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgctctggttctacgttctcgcaacagtcgctcccgttttcggggcgagcggttcttcc
aagagagcccaaaagccgcaaatgggcacgtgcaaacctcacatctccgtccgtgaacga
gactttactgatcttcgggcagggtggaattcttggaacaccttcaagctcggaatcaac
cagacgattgtcgaaggaaccgcgcaagctttagtggatactggacttcgtgatgctggc
tacacgtacctagtcatggatgatggctggcaaaatcttaccagaggtccggatgggagg
caacaagccaatgccacgcgctttccctccggccttaaggtacttgccgatgaggtccat
aagaagggcctcaagtttggcttatacagactggggtatggactatctgaaggattctac
ggcaatacccgaccactccaggagcgcttccaaatcatgtctcacgctttgaagaacaca
ggtcgcgacatcttctacgcagtttgtcaatggggccaccagtggccctggtactgggcc
gaccagttcactgattcatacagaatgtctggggacatccacgccaagtttcgcgatgac
gggaactccgtctgcaagactgcctactgtctcaacactggctacgctggtgttagcgtt
ctgaccatgattcgcaagatgcgcgagatctctggattccagaagaaaggctcctgggct
gatatggacatgctcgaggttggcgtcaaccgcaacttcacacttcaccaggatcagacc
cacctgagcttctgggcagccttgaagagccctctcatcattggtgcggacataagaaca
atcagaaaatcttctctcgatgtgctgttgaagaaagatatcattggaatcaaccaagat
gacctcggggtagctgtctcttatgtagctgaactctccaaagaggacgaaatccaggtc
tgggctggacctgtgaagtacaaaaagtacaatcatgttgtgcttgctctcaactacaat
gtggtgaatcacaccactgatattgagctgccatggtcaaaacttcccgggttccagggt
tgcaagaacggtaatgtccgtgtcagagatgtctgggaggacaaggatctgggatctcag
aaagaaagtatttccctccaggaggtgacgcaggatcaaacgaaggtgttgctgcttttc
tgcaagtag

DBGET integrated database retrieval system