KEGG   Verticillium alfalfae: VDBG_09650Help
Entry
VDBG_09650        CDS       T02227                                 

Definition
phosphatidylinositol 3-kinase tor2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
val  Verticillium alfalfae
Brite
Protein kinases [BR:val01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   VDBG_09650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2442 aa AA seqDB search
MATQQQIALERLETITRDLRSSRVSDDVRKRAALQLRELVLVCHRDLQPDHFNNIYHAVN
TRITQLIAHGSDSAERLGGVYALDSIVDIDATDQATKYARFLQNLKAILRGKDMSPMQAA
AVTLGKMCRPGGSVISELVESETQFALEWLQNERVEERRYSAALVLRELARQAPTLMYNY
VGLVLDLIWNSLRDSRQLIRSTSADTIAACFRIIRERDQEMKQAWMEKAYSELLRGLQNG
AVEYIHASLLMLKELLEQGGMFMQDHYPEACEIVLRYKEHKDGTIRKTVVLLIPDLASYS
PAEFDQSYLHKFMVYLIGMLKKDKERTDAFLAIGNIANSVKSAIAPYLDNLMIFIREGLS
VQARKRGSVDAVFECISRLAVAVGQTLSKYMEALLDPIFQCDLTPKLTQALVDMAFYIPP
AQDTIRNRLLDMLSMVLCGEPFKPLGAPHPNSLTSAPVITKDAKDPQAYEHRKAEIKLAL
NTLGSFDFTGHVLNEFVRDVAIKYVEDEDCEIREAAALTCCQLYVRDPIVNQTSYHALQV
VGDVIERLLTVGVSDPEPPIRRTVLAALDERFDRHLAKAENIRTLFFALNDEVFSIREVA
ISIIGRLARHNPAYVIPSLRKTLIQLLTELEFSDVARNKEESAKLLSLLVQNAQGLVKPY
VDPMMSVLIPKAKDPTPVVAATILRAIGELATVGGEDILPYKDKLMPLIIEALQDQSSSL
KREAALHALGQMASNSGYVIEPYLEYPELLEILQGIVRTEDHRGTLRQETIKLMGILGAL
DPYKYQQVEQRRPEVQRRAEVTPVSDVALMMSGLTPSNKEYFPTVVINSLLQILKDNSLV
AHHPAVIEAIMNIFRTLGLECVSFLDRIIPAFLAVIRAASNKRLESYFSQLATLVSIVRQ
HIRNFLPQIVEACQEYWNPKLGLQPTILSLVEAISRGLEGEFKIYLAGLLPLMLGALEVD
TSARRIPSERVLHAFLVFGSSSEEYMHLIIPVIVRTFEKQGQPTFLRKQAIETIGKISHQ
VNLNDYAAKIIHPLNRVLSGGDPALRVAALDTLCALIQQLGKDYTHFMGNVNKILAEHQI
QHANYELLTSKLAKGEVLPQDIGSADRFVDRVDDQIFSDLGSKKLEMNAIHLKTAWDTKG
KSTKEDWQEWLRRFSTTLLAESPNHALRACAALASSYLPLARELFNSAFVSCWSELYEQF
QDELIQNIENAIKSENVPPDLLGLLLNLAEFMEHDDKALPIDIRVLGHQAGRCHAYAKAL
HYKELEFLQDQSSGAVEALIGINNHLQQSDAAIGILRKAQLYKEGIQLRETWFEKLERWE
EALDFYNKREQDIPEDQAVPVDIIMGKMRCLHALGEWEALANIAGNTWSNSSPEVQRLIA
PLATAAAWGLSKWDSMDNYLQSMKRFSTDRSFFGAILALHRNQFREALNCVQQTREGLDT
ELSALVSESYNRAYTVVVRVQMLAELEELIFYKQTDEKKRATMRRTWEKRLKGCQRNVDL
WQRMLRLRQLVITPSENMHMWIKFANLCRKSGRMGLAEKSLKQLIGTESSLTSMIPYWND
RPQQPNVGLPRNVPSQIIYAMLKFEWEVGQQPANKTSGISEKTLYCLRKFTNDSAHRHEV
TKAHLTAQGQQGVDMSQEYNFPQGMEGGIMAPQTQRALQDQTVLLAKCYLRQGEWLIALN
KETWQYENVQDILTAYSQAAKYNPRWYKAWHAWALANFEIVQALTSRSELNRADQAMIVD
HVVPAVRGFFKSIALSSGSSLQDTLRLLTLWFTHGSSADVNAAVTEGFTNVSVDTWLEVI
PQLIARINQQSRRVQQTIHSLLADVGRAHPQALIYPLTVATKSWHSARRSRSAAQIMDSM
RQHSANLVSQADVVSNELIRVAVLWHEQWHEGLEEASRLYFGDHNIEGMFSTLEPLHDQL
ERGPETLREISFAQTFGRDLTEAREWCRQYESSRDVNDLNQAWDLYYQVFRRISRQLPQL
TSLELPYCSPKLLSAKDLDLAVPGTYRSGKPIVRIMDFEGTFSVINSKQRPRKITIGGSD
GVRYAFLLKGHEDIRQDERVMQLFGLCNTLLANDSECYKRHLNIERYPAIPLSQSSGLLG
WVPNSDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQD
LYRVLWLKSKSSEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRVTGKIIHIDF
GDCFEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCEHVMRVLRENKESVMAVL
EAFIHDPLLTWRLTNAASPTGPNFRSEREQAIAGPTASQTGPRGRRPSMLDADVAPTELL
AAAGGDASALVGGPHTARSRARTNSSIAPSTSLVNGNNVMDPADAQNARAIEVLDRVSQK
LRGKDFKPNEELDIVAQVNKLITEATKLENLCQHYIGWCSFW
NT seq 7329 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcaacaacagatcgctctcgagcgattggagacgatcacgagagacctccga
tcgagtcgggtcagtgacgatgtaagaaaacgcgccgctcttcaactgcgagagctggtt
ctggtgtgccaccgagatcttcagccggatcatttcaacaacatttaccatgcggtgaac
acccgaattactcaactcattgctcacggcagcgactcggccgaacgtttgggcggtgtc
tacgccctggacagcattgtggatattgatgcaaccgaccaggccacgaaatatgctcgc
tttctccagaacctgaaggctatccttaggggcaaggatatgagccccatgcaagctgct
gctgtcactctcggcaaaatgtgtcgccctgggggttccgtcatcagcgagcttgttgag
tctgaaacccaatttgcccttgagtggctacaaaacgagcgtgtagaggagcgccgatac
agcgccgccttggtcctgcgcgagctcgccagacaagctccgacactgatgtacaactac
gttggcttggtgcttgatctcatatggaacagtttgcgcgacagccgacaactcatccgc
tctacatctgccgatacgatcgctgcctgtttccgcatcattcgtgagcgcgaccaagaa
atgaagcaggcctggatggaaaaggcatacagcgagcttctccgaggtctccagaacggc
gctgtggaatacatacacgcgtctctcctcatgctgaaagagctgttggaacaaggcggc
atgttcatgcaagaccattatcccgaagcttgcgagattgttctgcgctataaggagcat
aaagatggcaccatccggaagacggtggtcctcttgatccccgaccttgccagctactct
cccgccgagtttgaccagagctacctccacaaattcatggtctacctgatcggcatgctg
aagaaggacaaagaacggacagatgcttttctggcaataggcaatatcgccaactctgtc
aagagcgccatcgctccctatcttgacaatctcatgatcttcatccgcgaagggctgagt
gtgcaggctcgcaagcgcggttccgttgacgccgtgtttgagtgcatcagccgccttgct
gtggctgtcggccagacactcagcaagtacatggaagccctcctcgatcccattttccag
tgcgacttgacaccaaagttgacacaagcccttgtggatatggcattttatattcctccc
gcacaagacaccatccggaaccggcttctggacatgctgagcatggtcctttgtggcgaa
cctttcaaaccgttgggcgcccctcatcctaactccctgacttcggcaccggttatcacc
aaggatgccaaggatcctcaggcttatgaacatcgcaaggccgagatcaagctggccctg
aacactctcggcagctttgactttactggacacgttctcaacgaatttgtccgagacgtc
gccatcaagtacgttgaggacgaagactgtgaaatccgcgaggcggctgccttgacctgc
tgccagctttatgtcagggatcccatcgtgaaccagacgagctatcacgctttgcaagtg
gtgggcgacgtcatcgaaaggcttctcacagtcggcgtgtcggaccccgagccgcctatc
aggcggaccgtactggcggcgcttgacgagcgtttcgatcgccatcttgccaaagcagag
aacatccgtactcttttcttcgctttgaatgacgaggtcttctctatccgagaagttgcc
atctcgattataggccgactggcacgtcacaaccccgcctatgtcattccctcccttcga
aagacgttaatccaattattgacggaacttgagttctcagacgtcgcccgcaataaggag
gaaagcgcgaagcttttgagtcttcttgttcaaaacgctcaagggcttgttaagccttac
gtcgacccgatgatgtcagtgctcatccccaaggccaaggacccgacgccagtcgtggcc
gccacaattctgagagccataggagaacttgccacagtcggcggcgaagatattctccca
tacaaggacaagcttatgcccctcatcatagaggcgcttcaagaccagagctcaagcctc
aaacgcgaagcggctctccacgcgctcggccagatggccagcaactctggctatgtcatt
gaaccatatcttgaataccctgagctcctggaaattctacagggtatagtacgcactgaa
gatcatcgaggtacacttcgacaagaaacgatcaaacttatgggtatcttgggtgccctc
gatccttacaagtaccaacaggtcgaacagcgccgacctgaagtccagcgacgagccgaa
gtgaccccggtcagcgacgtggccctcatgatgtccggtctcacgccctccaacaaagaa
tatttccccactgtggtgatcaactctttgctacagatcctcaaggataactctctcgtg
gcgcatcatcctgcggtcatcgaagccattatgaacattttccggacgctcggactcgag
tgcgtcagttttctcgacagaatcattccggccttcctcgctgtcatcagggctgcctcg
aacaagagacttgagtcttacttcagccagctcgctacgctcgttagcatcgtgcggcag
cacattaggaacttcttaccgcagattgtagaagcctgccaggagtactggaatcctaag
ctcggccttcagcctaccattctgtcacttgtcgaagcgatttctcgtggactagaaggc
gagttcaagatttatcttgctggtctcctccccttgatgcttggagccctagaggtggat
acctcggcacgacgcattccttcagaaagggttcttcacgcctttcttgtgttcggatca
agcagcgaggagtacatgcatctgattattcccgttattgttcgcacattcgagaagcag
ggccagccaacgtttctccgcaaacaagccattgagacgattggcaagatatcccatcaa
gtgaacctgaacgactatgcggccaagattattcacccactgaaccgcgtgctcagcggt
ggtgatccggccttgcgagttgccgctctggacactctctgcgcgttgattcagcagcta
ggaaaagactacacacacttcatgggcaacgtgaacaaaatcctcgcggagcaccagatc
caacatgccaactacgagctactcacgagcaagcttgccaagggcgaagtgctgccgcaa
gacattggctctgccgatagattcgtagatcgagtcgatgaccaaatcttttctgacctg
ggttccaaaaagcttgagatgaatgccattcacctcaaaacggcatgggacacgaaggga
aagtcgaccaaggaggactggcaggaatggctccgtcgcttctctacgactcttttggca
gaatcccccaaccacgctctgcgtgcatgcgccgctctggccagctcctacctaccactc
gcccgagaacttttcaactcagcatttgtttcgtgctggtctgagttgtacgagcagttt
caggacgagctgatccaaaacatcgagaatgcgataaagtcggagaatgtgcccccggac
ctgctgggacttttgcttaatctcgctgagtttatggaacatgatgacaaggcgctacca
atcgacattcgtgtccttggccatcaggcaggtcgctgccatgcctacgccaaggccctc
cactacaaggagcttgaattcctccaggaccagagcagtggggcggtcgaggctctcatc
ggcatcaacaatcacctgcagcagtccgatgcggccattggcatcctccgcaaggcccag
ctctataaggaaggtatccagcttagagagacatggttcgagaagctggagcgctgggag
gaagctcttgacttttacaataaaagggagcaagacatccctgaagaccaagctgttcct
gtcgatatcatcatgggcaagatgcgctgcctgcacgccctgggcgaatgggaggctctt
gcgaacattgccggcaacacttggtctaactcgtcgccggaagtgcagcgcctcattgct
cctctggccacggccgccgcctggggtctgtctaagtgggattccatggacaactatctc
cagtcgatgaagcgtttctcgacggatcgctcgttctttggcgccattctcgccctgcat
cgcaaccagttccgagaagcgttgaactgcgtgcagcagacgcgtgagggtcttgataca
gaactcagtgccctggtcagcgagtcatacaaccgggcgtacacggtcgtcgttcgcgtc
caaatgctggccgaactcgaagagcttatcttctacaagcagacagatgagaagaagcgc
gctaccatgcgacgcacttgggagaagcgcctcaaggggtgtcaacgtaacgtggacctt
tggcagcgcatgcttcgtctcaggcagcttgtcatcactccctccgagaatatgcacatg
tggatcaagtttgccaacctttgtcgcaagtcgggtcgtatgggcttggccgaaaagtcg
ctgaaacagctcatcggaaccgagtcctcgcttacgtccatgatcccatattggaatgac
cgaccccagcagcccaacgtgggtctaccccggaacgtcccatcgcaaatcatctatgcc
atgctcaagttcgaatgggaagtcggccagcaacccgcgaataagacttcgggtatctcg
gagaagactctctactgtctgcgcaagtttactaacgattcggcacaccgacacgaggtc
accaaggcgcatctcaccgcccaaggacaacaaggtgtagacatgagccaagagtacaac
ttcccgcaaggtatggaggggggcatcatggcgcctcagacccagcgtgccctccaggac
cagacggtgctcctcgcaaagtgttatctcagacagggcgagtggctcattgcgctcaat
aaggaaacatggcaatacgaaaacgttcaggacatattaactgcctactcccaggcggcc
aagtataacccacgttggtacaaggcgtggcacgcatgggcgttagccaacttcgagatt
gtgcaggcgttgaccagcaggagcgaacttaaccgggcggaccaggccatgatcgtcgat
catgtcgtcccggcggtgcggggcttcttcaagtctatcgctctgtcatctggcagctcg
ctgcaggacacattgcgtctccttacattatggttcacacacggctcgagtgctgacgtc
aacgctgcagtcactgagggcttcaccaatgttagcgttgatacttggcttgaagtcatt
cctcagctcatcgcccgcatcaaccaacagtctcgtcgcgtgcagcagacgattcacagc
cttctggctgatgtcggcagagcccacccgcaggccctcatttaccctctcactgtggcc
acaaagtcgtggcacagtgcccgccgctcccgatccgcagcgcagattatggatagtatg
cgtcagcactcggccaatctcgtctcccaggcagatgtcgtcagtaacgaacttatcagg
gttgccgtcctatggcacgagcagtggcacgagggtctggaagaggcatcacgactgtac
tttggcgatcataatatcgagggcatgttctcgactcttgagcccctccatgaccagctg
gagcgcgggcctgagacacttagagagatctcgttcgcgcaaacgtttggtagggacctg
acggaggcgcgggagtggtgccgacagtatgagtcgagccgagatgtgaacgacctcaac
caagcctgggacttgtactaccaagtcttccgtcgcatatcgcgacagttgccgcagctc
acgagcctggaactaccctactgctcacccaagctgcttagcgccaaggatctcgacctc
gccgtacctggaacgtatcgaagcggaaagcccattgtccgtatcatggattttgagggc
accttttcggtcatcaacagcaagcagcgcccgcgtaagataacgattggcggcagcgac
ggtgtgcgatacgcgttcctcctcaaaggccacgaggacattcgccaagacgaacgtgtc
atgcaattgtttggcctttgcaacacgctgctggcgaacgactcggagtgctacaagcga
catctcaatatcgagcgttatccagcgattccgctgtcgcagagctcaggtctccttggc
tgggtgccaaatagcgacacgctccacgtacttattagggaatatcgtgagagccgcaag
atcttgttgaacattgagcatcggataatgttgcagatggctcccgactatgacaacttg
actctcatgcagaaggtggaggtctttggctacgcgcttgataacaccaccggccaagat
ctgtaccgcgtactgtggctcaagagtaagagttctgaggcctggctcgagcggcgcacc
aactacacgcgctctctcggcgtcatgtccatggtcggctacatcctgggtctgggtgat
cgtcacccttcgaacctaatgctagatcgtgtcaccggcaaaatcattcacattgatttc
ggtgattgcttcgaagtcgcaatgaaacgcgagaagtatccggaacgcgtgcccttccgc
ctcacgcgcatgttgacgtatgccatggaggttagcaacatcgagggcagcttcagaatc
acatgcgagcatgtgatgcgggttctgcgcgagaataaggaaagcgtcatggccgttttg
gaagctttcatccacgatcccctgctgacttggcgccttacgaatgcggcaagtccaacg
ggaccaaacttccggtccgaacgtgaacaggccatcgctggtcccacggcgtcgcagaca
ggtcctcgcggtcgccggccttcaatgctcgatgccgacgtggcaccgacggagctactc
gcggcagcaggcggcgatgcctccgcactagtaggtgggccgcatacagcaaggtccagg
gcgcgcaccaactcgtccatcgcgccgagcacgagcctggtcaacggtaataacgtcatg
gaccccgccgatgcacaaaatgcgcgggcgattgaggtcctggatcgcgtttcgcagaag
ctgaggggtaaagacttcaagcctaacgaagagcttgacatcgtcgcgcaggtcaacaag
ctcatcacggaggccaccaagctggagaacctgtgtcagcactacataggatggtgcagc
ttctggtaa

DBGET integrated database retrieval system