KEGG   Verticillium alfalfae: VDBG_09674Help
Entry
VDBG_09674        CDS       T02227                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
val  Verticillium alfalfae
Brite
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VDBG_09674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MPPKAADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRTKTRKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaaggccgccgacaagaagcccgccagcaaggcccccgctactgcctccaag
gctcctgagaagaaggatgccggcaagaagaccgctgccagcggtgacaagaagaagcgc
accaagactcgcaaggagacatactcttcttacatctacaaggtcctcaagcaggtccac
cccgacactggtatctcgaaccgtgccatgtccatcctgaactctttcgtcaacgacatt
ttcgagcgtgtcgccaccgaagccagcaagcttgccgcctacaacaagaagtccaccatc
tcctccagggagattcagacctctgttcgccttattctccccggtgagctggccaagcac
gccgtttctgagggcaccaaggccgtcaccaagtactcctcgtccacgaaataa

DBGET integrated database retrieval system