KEGG   Verticillium albo-atrum: VDBG_09706Help
Entry
VDBG_09706        CDS       T02227                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
val  Verticillium albo-atrum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:val00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VDBG_09706
Enzymes [BR:val01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VDBG_09706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 301 aa AA seqDB search
MSASQASVNGAVPILLLKTRSSPGDSYEDLFESTNEDGWSFEPTFVPVLQHTLIREGLDE
VRTLLQNRGIRSDEGASYGGLIFTSQRAVEAFTSLSVPVYSVAPRRRGAWSPGPRTPPLA
IHGSHTGNGDALAAFILDDYAVARYPARVPKPPLLFLVGEQRRDIIPRTLTDPTLPADRR
IPVTEGDRLRHGASCPRSPDHLARLLDETASRPVRWVVVFSPTGCDSLLRGLGLLDEASG
RARPAEARDGRTYVATIGPTTRDYLRRTFGFEPDVCAATPSPEGVRRAIVDFTTSHSGSK
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcacaagcaagtgtcaacggcgcggtgccaatactgttgctcaagacgaga
tcgtcgccgggagattcgtacgaagatctgttcgagtcaaccaacgaggacggctggtcc
ttcgagcccactttcgtccccgtgctgcagcacaccctcatccgagagggcctggatgag
gtgcggacccttcttcagaaccgaggcattcgttcagacgagggcgcgtcctacggcggc
ctcatcttcacctcccaacgcgccgtcgaagccttcaccagcctctctgtccccgtctac
agcgtcgccccgcgacgacgcggggcctggtcgccgggtcccagaacgccgcccctggcc
atccacggctcccacaccggcaacggggacgccctcgccgcgttcatcctcgacgactac
gctgtggcccgctaccccgcgcgcgtgccgaaaccgccgctcctgtttctcgtcggcgag
cagcgcagggacatcatcccccgcaccctcaccgacccaaccctgccggcagaccgccgc
atccccgtgaccgagggtgaccgtctacggcacggggcgtcatgcccacgttcccccgac
cacctcgcgcgcctcctcgacgagacggcatcgcgccccgtgcgctgggtcgtcgtcttc
tcgcccacgggctgcgacagcctgctgcgcggcctgggtctcctcgacgaggcgtcgggc
agggcgcgccccgccgaggccagggacggcaggacctacgtcgccaccatagggcccacg
acgagggactacctgcgacggacctttggctttgagccggacgtgtgcgctgcgacgccg
tctccggaaggcgtgcggcgggctattgtcgactttacgacgagccattccgggtcgaag
gagtag

DBGET integrated database retrieval system