KEGG   Verticillium albo-atrum: VDBG_09832Help
Entry
VDBG_09832        CDS       T02227                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
val  Verticillium albo-atrum
Brite
Enzymes [BR:val01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VDBG_09832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 236 aa AA seqDB search
MAWRSSGDTNQALAENLWRNSLIKDERVKDAFLKVDRAHYAPKSPYADHPQSIGHGATIS
APHMHAMAAESLLPFVVPSQRTPAPRVLDIGSGSGYLTHLLAELVGESGTVVGVEHIDEL
RQLGEGNMTKSEEGGGFLGSGRVKFCTGDGRAGWTEDGNDVWDAIHVGAAAVELHQTLVD
QLRSPGRLFIPVADEDGSGNQYIWTVDKKEDGTVVKEKKFGVSVLSSEQASFVPRM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgcagctcgggcgacacaaatcaggccctggccgagaacctctggcgcaac
agcctcatcaaagacgagcgtgtcaaagatgcctttctaaaggtcgatcgcgcgcactac
gctcccaagtcgccctacgcagaccatccgcagtccatcggccacggcgccaccatttcc
gccccgcacatgcatgccatggccgccgagtcgttgttgccctttgtcgtcccctcgcaa
cgaacgccggcgccgcgggtgctggacattggctctggctcgggctacctgacacatctg
ctcgcggagctcgtgggcgagagcggcacagttgtgggcgttgagcatatcgacgagctg
cggcagctgggtgagggcaacatgaccaagagcgaagagggcggagggtttctcggaagc
ggcagggtcaagttctgcacgggcgacggaagagctgggtggacggaggacggcaatgac
gtatgggatgctattcatgtgggtgcggcggctgtcgagttgcatcagacgctcgtcgac
cagttgcggtctccgggacggctgttcattccggttgcggatgaggatggtagcgggaac
cagtatatttggacggttgacaaaaaggaggacggtacggtggtcaaggagaagaagttc
ggcgtaagtgtgttgagctcagagcaagcttcgttcgtgccccgtatgtag

DBGET integrated database retrieval system