KEGG   Vibrio anguillarum 775: VAA_00466Help
Entry
VAA_00466         CDS       T01536                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
van  Vibrio anguillarum 775
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VAA_00466
  Lipid metabolism
   00600 Sphingolipid metabolism
    VAA_00466
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VAA_00466
Enzymes [BR:van01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VAA_00466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:99264..102365
Genome map
AA seq 1033 aa AA seqDB search
MKAFSDILQRRDWETPQSVNIHCLKAHSPLSSYRDIDHARDGVYAQRQSLNGQWKFKVFD
SPEQVEGEFIQTKFNDTNWDEITVPSNWQLQGYDKPIYTNVKYPFEVNPPFVPAENPTGC
YRTTISRSEADLANTQRIIFEGVNSAFHLWCNGTWVGYSQDSRLPSEFDLSPYLVAGENT
LAVMVMRWCDGSYLEDQDMWWLSGIFRDVTLLSKPQYCIEDVFVTPDLDACYRDGSLSIV
THISAPDCYQVQVQLFDGECAVTEPRIDRPHNRRIDERGTYDDVVFQTLHVREPNKWSAE
TPNLYRLVVSLLDKNGMHLESEAYHVGFRKVEITDGQLKLNGKPLLIRGVNRHEHHPELG
HVMTEEDMIRDICLMKQYNFNAVRTAHYPNHPRWYELCDQYGLYVCDEANIETHGMQPMN
RLSSNPQWAHAYMSRYTQMVMRDKNHPSIIIWSLGNESGHGSNHHAMYAWSKNYDPSRPV
QYEGGGANTAATDIIAPMYARVNTTIADEAVPKWPIKKWISLPNETRPLILCEYAHAMGN
SLGSFNEYWDAFREFPRLQGGFIWDWVDQGLSQWDENGQHFWAYGGDFGDKINDRQFCIN
GLIFPDRTVHPTLEEAKYCQRMIRVSLQEQAKGFCHLLVTNENLFRATDNEQLNWSLLED
GKLIQSGSVVLNIKADSQATVDIAFEFTPKAEARYHLNTDITLVAETLWAPAGYVIASEQ
FALHNTAGLAMPKLETQPAPAITQQKGMIVVTSLDEKHQWCWDSQTGLMIDWQVDGKARM
LAAPQDNFFRAPLDNDIGVSEVDNVDPNAWVCRWDMAGIGQWKRECVSCHSDMLAHAVQV
TSTFAYQFNGAVQAITTWTHTLKNSGEMQLAVDVTLADDLPPMPRIGLELQLPLHEQNTP
ITWQGLGPFENYPDRLSAARFGLHTQTLEEMHTPYIFPTDSGLRCGTQWLQVNELVMSGD
FQFSVSQYAQQTLAKAKHTCDLMAETTIYVRLDHQHMGVGGDDSWSPSVHKEFQLTGNNY
VYRISFKAISHRI
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcattttcagatattctccaacgacgtgactgggaaaccccgcaatcagtgaat
attcactgcttaaaagcacacagcccactttccagttaccgagatattgaccatgcccgt
gacggcgtttacgcccaacgtcaatcgctgaatggccaatggaaattcaaagtgttcgac
tcgccagaacaagtcgaaggcgagtttattcaaaccaaattcaatgacacgaactgggat
gaaataacggttccttccaactggcagctacaaggctacgacaaaccaatttacaccaac
gtaaaatacccgtttgaagtaaaccctccattcgtgcccgctgaaaacccgacaggttgt
taccgcactacgatttcccgctcagaagccgatcttgccaatacccagcgcatcatcttc
gagggtgtgaactcagcattccacctatggtgcaacggcacttgggtgggatacagccaa
gatagccgcttgccttccgaattcgacttatcgccctacctagtggctggcgagaataca
cttgccgtgatggtgatgcgttggtgtgatggcagctacctagaagaccaagacatgtgg
tggctaagtggtattttccgcgacgtaactttgctttctaaaccgcaatactgcattgaa
gatgtattcgtcacgccagatttggatgcgtgttatcgcgatggttcactatcaatcgtg
acgcatatttcagcgccagattgttaccaagtgcaagtgcagctctttgatggtgaatgc
gcggtgactgagccgcgaattgatcgaccgcacaaccgccgtattgacgagcggggcaca
tacgatgacgtggtatttcaaacattgcatgtgcgtgagccaaacaaatggagcgcagaa
acccccaatctataccgcctagtcgtttcactattagataaaaacggcatgcatctagag
agtgaagcctatcatgtgggctttcgcaaagtggaaattactgatggtcagttgaaactc
aacggcaagcctttgctgatccgtggcgttaaccgtcatgagcatcatccagagcttggg
catgtaatgacagaagaagacatgatccgcgacatctgtttgatgaagcaatacaatttc
aacgcggtacgtacagcgcactacccaaatcaccctcgttggtacgaactgtgtgaccaa
tacggcttgtacgtgtgcgatgaagcgaacatcgaaacccatggcatgcagccgatgaat
cgcctttcgagcaatccacaatgggcgcacgcatacatgagccgctacacccaaatggtg
atgcgcgataaaaaccatccttctatcatcatctggtctttgggtaacgagtctggccac
ggcagcaaccaccatgcgatgtacgcttggtcgaaaaactacgatccgtcgcgccctgtt
caatatgaaggtggcggtgccaataccgctgcaaccgacatcattgcgcctatgtacgcc
cgtgtgaatacaacgattgcagatgaagcagtaccaaaatggccaatcaaaaaatggatt
tctctacccaacgaaactcgcccactgatcttatgtgaatacgcccacgcgatgggtaac
agtttggggagttttaatgaatattgggatgcattccgcgagtttcctcgccttcaaggc
ggctttatctgggattgggtagaccaaggcttgagccaatgggacgagaacggccaacac
ttctgggcttacggtggcgattttggcgataaaatcaatgaccgccagttctgcatcaac
gggttgatcttcccagatcgcactgtgcatccaacattggaagaagccaaatactgccag
cgtatgattcgcgtgtcgctgcaagaacaagcgaaaggattctgtcatctattagtaact
aacgaaaacctatttcgtgcaacggacaacgagcaattgaactggtcacttttggaagat
ggcaaattgattcaatctggctcagtggtgctgaacatcaaagccgatagccaagcaacc
gtagatattgcttttgaatttacacctaaagcagaagcgcgataccacttgaatactgac
atcaccttagtggctgaaacactttgggcaccagcgggatatgtgatcgcttctgagcaa
tttgcgctacacaataccgcaggtctcgccatgcctaagttggaaacgcaaccagcccca
gcaataacccagcaaaaaggcatgatcgtagtcaccagcctagatgagaagcatcaatgg
tgctgggatagtcaaacaggcttgatgattgattggcaagtcgatggcaaagcgcgaatg
ctggcggcaccgcaagataacttcttccgtgcgccactggataacgatattggtgtgagt
gaagtggataacgtagatccaaacgcttgggtatgtcgttgggatatggctggtattggc
caatggaaacgcgaatgtgtcagttgccatagcgacatgttggcgcatgccgtgcaagta
acatcaactttcgcttaccaattcaacggtgccgtgcaagccatcaccacttggacgcat
acgctgaaaaacagtggcgaaatgcagttggccgttgatgtgacacttgccgatgatctg
ccacccatgccacgtatcggcttggagctgcaattgccattgcatgagcagaatacacca
atcacttggcaaggtttaggtccgtttgagaactacccagaccgcctatctgcagcacgt
tttggcttgcacacgcaaacgctagaagagatgcacactccgtacattttcccaaccgac
agtggcttacgttgtggaactcaatggctgcaagtgaacgaactagtgatgtctggcgat
ttccaatttagtgtcagtcaatatgctcaacagacgctggcaaaagcaaaacacacctgt
gatttaatggcagaaacaaccatttatgtgcgcctagaccatcagcatatgggcgtgggt
ggtgatgattcttggagccctagtgtgcacaaagaattccagctaactggcaataattac
gtttaccgaatatcgttcaaagcaatttcgcatcgtatttaa

DBGET integrated database retrieval system