KEGG   Vibrio anguillarum 775: VAA_00531Help
Entry
VAA_00531         CDS       T01536                                 

Definition
(RefSeq) Malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
van  Vibrio anguillarum 775
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAA_00531
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAA_00531
   00630 Glyoxylate and dicarboxylate metabolism
    VAA_00531
Enzymes [BR:van01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VAA_00531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2504762..2506417)
Genome map
AA seq 551 aa AA seqDB search
MVLRKNVMFAQTPETELALSKEHHEAKLEVVGAVGPHHQAIFPSEAQIFLSTLCAKFASR
VDSLLDAREERQTRIDNGELPDFLKDTQDIREGSWKILGIPHDLQDRRVEITGPTDRKMV
INALNANVKVFMADFEDSMSPAWDKVLDGQVNLRDAIEGTISYTNPDNGKCYQLKDNPAV
LICRVRGLHLKEKHVKYAGQSIPGSLFDFALYFYNNYKSLLKKGSGPYFYLPKLQAYQEA
KWWSDVFHFTEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFS
YIKTLKNYPDRVLPDRQVVTMEKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPQEN
QLVLDKIHHDKLLEANNGHDGTWVAHPGLADTAKAVFDQVLGERCNQLDVTRLSDAPIHA
NELLTPCEGERTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWI
KHGKALDNGQIVTKALFEQYLAQEIEVVKQEIGTQRFAQGRFSEAAQLMARLTTSDELTH
FLTVPGYDYLD
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggttttaaggaagaacgttatgtttgcacagaccccagaaacagagttagcactcagc
aaagaacaccacgaagccaagcttgaggttgttggtgccgttggcccacatcaccaagct
attttcccttcagaagcccaaatcttcttgtccactctgtgtgctaaatttgcaagccgt
gtcgattcgctgctggatgcacgagaagagcgacaaacacgtattgataacggagaactg
ccggattttctcaaggatacgcaagatattcgcgaaggaagctggaaaattctcggtatc
ccacacgatttacaagatcgtcgagtggagattacggggccaaccgaccgaaaaatggtg
atcaatgcattgaatgctaacgtcaaagtgttcatggcggattttgaggattcgatgtca
ccagcatgggataaagtgctggatgggcaagtcaatttgcgtgatgccattgaaggaacc
attagctataccaatcctgacaatggtaagtgctaccagcttaaagataacccagcggtg
ctcatttgtcgggtacgcggtctgcaccttaaagaaaagcatgttaaatatgcagggcaa
agtattccgggttcgttgtttgattttgcactctacttttacaacaactataaatcattg
cttaaaaaaggcagtggcccttatttttatcttccaaaacttcaggcctatcaagaagca
aagtggtggagtgacgttttccattttaccgaagagtattttgggttagaaactggcacc
attaaagccaccgtattgattgaaaccttacccgccgtgttcgagatggacgaaatattg
ttctcgcttaaagaacacattgtcggcttaaattgtggccgctgggattacattttcagt
tatatcaagacattgaaaaattatccggatcgggtgctaccagatcgccaagttgtcaca
atggaaaagccgtttcttaacgcttattcacgcttgctgatctatacctgtcataagcgt
ggcgcatttgcgatgggcggtatggccgcgttcattccagctaaagatccccaagaaaat
cagttggttctcgataaaattcatcacgataaattactcgaagccaataatggtcatgac
ggtacttgggttgcccatccaggtttagcggatacggcaaaagcggtctttgaccaagta
ctgggcgagcgttgtaaccaattagatgttacgcgtctgtctgatgcgccgattcatgcc
aatgagctgttgaccccatgtgaaggggaacgtaccgaacagggcatgcgtcataatatt
cgagttgcacttcagtacatcgaagcatggatctccggcaatggctgtgtccccatttat
ggtttgatggaagatgcggcgactgcagagatttctcgagcgtcaatatggcaatggatc
aagcatggaaaagccttggataacggtcagattgttaccaaagcgctttttgagcagtat
cttgcgcaagaaattgaagtcgtgaaacaggaaatcggcacgcagcgatttgcacaagga
cgatttagcgaagcggcacaattgatggctcgcttaactaccagcgatgagctgacacat
tttctcaccgttccgggttatgactacctagattga

DBGET integrated database retrieval system