KEGG   Vibrio anguillarum 775: VAA_00531Help
Entry
VAA_00531         CDS       T01536                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
van  Vibrio anguillarum 775
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAA_00531
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAA_00531
   00630 Glyoxylate and dicarboxylate metabolism
    VAA_00531
Enzymes [BR:van01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VAA_00531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2504762..2506417)
Genome map
AA seq 551 aa AA seqDB search
MVLRKNVMFAQTPETELALSKEHHEAKLEVVGAVGPHHQAIFPSEAQIFLSTLCAKFASR
VDSLLDAREERQTRIDNGELPDFLKDTQDIREGSWKILGIPHDLQDRRVEITGPTDRKMV
INALNANVKVFMADFEDSMSPAWDKVLDGQVNLRDAIEGTISYTNPDNGKCYQLKDNPAV
LICRVRGLHLKEKHVKYAGQSIPGSLFDFALYFYNNYKSLLKKGSGPYFYLPKLQAYQEA
KWWSDVFHFTEEYFGLETGTIKATVLIETLPAVFEMDEILFSLKEHIVGLNCGRWDYIFS
YIKTLKNYPDRVLPDRQVVTMEKPFLNAYSRLLIYTCHKRGAFAMGGMAAFIPAKDPQEN
QLVLDKIHHDKLLEANNGHDGTWVAHPGLADTAKAVFDQVLGERCNQLDVTRLSDAPIHA
NELLTPCEGERTEQGMRHNIRVALQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWI
KHGKALDNGQIVTKALFEQYLAQEIEVVKQEIGTQRFAQGRFSEAAQLMARLTTSDELTH
FLTVPGYDYLD
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggttttaaggaagaacgttatgtttgcacagaccccagaaacagagttagcactcagc
aaagaacaccacgaagccaagcttgaggttgttggtgccgttggcccacatcaccaagct
attttcccttcagaagcccaaatcttcttgtccactctgtgtgctaaatttgcaagccgt
gtcgattcgctgctggatgcacgagaagagcgacaaacacgtattgataacggagaactg
ccggattttctcaaggatacgcaagatattcgcgaaggaagctggaaaattctcggtatc
ccacacgatttacaagatcgtcgagtggagattacggggccaaccgaccgaaaaatggtg
atcaatgcattgaatgctaacgtcaaagtgttcatggcggattttgaggattcgatgtca
ccagcatgggataaagtgctggatgggcaagtcaatttgcgtgatgccattgaaggaacc
attagctataccaatcctgacaatggtaagtgctaccagcttaaagataacccagcggtg
ctcatttgtcgggtacgcggtctgcaccttaaagaaaagcatgttaaatatgcagggcaa
agtattccgggttcgttgtttgattttgcactctacttttacaacaactataaatcattg
cttaaaaaaggcagtggcccttatttttatcttccaaaacttcaggcctatcaagaagca
aagtggtggagtgacgttttccattttaccgaagagtattttgggttagaaactggcacc
attaaagccaccgtattgattgaaaccttacccgccgtgttcgagatggacgaaatattg
ttctcgcttaaagaacacattgtcggcttaaattgtggccgctgggattacattttcagt
tatatcaagacattgaaaaattatccggatcgggtgctaccagatcgccaagttgtcaca
atggaaaagccgtttcttaacgcttattcacgcttgctgatctatacctgtcataagcgt
ggcgcatttgcgatgggcggtatggccgcgttcattccagctaaagatccccaagaaaat
cagttggttctcgataaaattcatcacgataaattactcgaagccaataatggtcatgac
ggtacttgggttgcccatccaggtttagcggatacggcaaaagcggtctttgaccaagta
ctgggcgagcgttgtaaccaattagatgttacgcgtctgtctgatgcgccgattcatgcc
aatgagctgttgaccccatgtgaaggggaacgtaccgaacagggcatgcgtcataatatt
cgagttgcacttcagtacatcgaagcatggatctccggcaatggctgtgtccccatttat
ggtttgatggaagatgcggcgactgcagagatttctcgagcgtcaatatggcaatggatc
aagcatggaaaagccttggataacggtcagattgttaccaaagcgctttttgagcagtat
cttgcgcaagaaattgaagtcgtgaaacaggaaatcggcacgcagcgatttgcacaagga
cgatttagcgaagcggcacaattgatggctcgcttaactaccagcgatgagctgacacat
tttctcaccgttccgggttatgactacctagattga

DBGET integrated database retrieval system