KEGG   Vibrio anguillarum 775: VAA_00577Help
Entry
VAA_00577         CDS       T01536                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
van  Vibrio anguillarum 775
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VAA_00577
Enzymes [BR:van01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VAA_00577
Exosome [BR:van04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAA_00577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:293861..294955
Genome map
AA seq 364 aa AA seqDB search
MKKECFLTPRINKEKRVSVSIQGQFPGRRMRRLRKHDFSRRLMAENQLSVNDLIYPMFIL
MGKDRREPVESMPGIERLSIDLMLEEALYLANLGVPAIALFPVVNQDAKSLCAAEAHNPD
GLVQRAVKLLKEHIPQMGVITDVALDPFTTHGQDGIIDESGYVMNDETTEVLIKQALSHA
AAGADVVAPSDMMDGRIGKIREALEEAGFIHTQIMAYSAKYASCYYGPFRDAVGSSSNLK
GGDKKNYQMDPANSDEAIHEVAMDINEGADMVMVKPGMPYLDVVRRVKSELQVPTFAYQV
SGEYAMHKAAILNGWLKERETVMESLLCFKRAGADGILTYFAKDVAQWLAEDNAKTAQYL
HQDN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaagaatgctttctcacaccgcgtataaacaaggagaagagagtgtcagtatcc
attcaaggtcagttcccagggcgtcgcatgcgtcgcttacgcaagcatgattttagccgc
cgtttgatggctgagaatcagttatcggttaatgatttaatttatcccatgtttattttg
atgggtaaagatcgccgcgagccagtggagtctatgcccggtattgagcgtctctctatc
gacttaatgctcgaagaagcgctgtatttggctaatctcggcgtgccagccatcgcactt
tttccagtggttaaccaagatgctaaaagtttgtgtgctgctgaagcgcataatcctgac
ggcttagtgcaacgtgcggtgaaattattaaaagagcatataccacaaatgggtgtcatt
accgacgtcgcgctggatcctttcacgacccatggccaagatggcatcatcgatgaaagt
ggctatgtgatgaatgatgagaccaccgaggtgttgatcaaacaagcgctgtctcacgct
gcagccggtgccgatgtggttgccccttccgatatgatggatggacgaattggtaagatc
cgcgaagcgcttgaagaggcgggttttattcatacacagatcatggcttactctgcgaaa
tacgcgtcatgttattacggcccattccgcgatgcggttggttcctcttcgaacctgaaa
gggggagacaagaaaaactatcagatggatccggccaacagcgatgaagccattcacgaa
gtggcgatggatatcaatgaaggggctgacatggtgatggtgaagcccggcatgccatac
cttgatgtggtgcgccgcgtgaaatctgaattacaagttcctacgtttgcgtatcaagtg
tctggtgaatatgcgatgcataaagcagccattttaaatggttggcttaaagaacgtgaa
accgtaatggagtcattattgtgctttaaacgcgcaggggcagacggcattttaacctat
tttgctaaagacgttgcgcagtggctggcagaagataacgccaaaacggcacaatattta
catcaagacaactaa

DBGET integrated database retrieval system