KEGG   Vibrio anguillarum 775: VAA_00618Help
Entry
VAA_00618         CDS       T01536                                 

Definition
Guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
van  Vibrio anguillarum 775
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VAA_00618
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VAA_00618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:11927..12550
Genome map
AA seq 207 aa AA seqDB search
MGKGTLYIVSAPSGAGKSSLISAMLETNPTYAMKVSVSHTTRGMRPGEQDGVHYHFVQKE
LFEELITKGEFLEHAEVFGNYYGTSKVWIENNLNKGIDVFLDIDWQGARQIRDKMPEAKS
VFILPPSKEELERRLNARGQDSEAVIAKRMNEAQAEISHYTEYDYVIINDDFDVALMDFR
AILRAERLKQDKQAAKYNSMLNALLAE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtactctttatatcgtctctgcacccagtggtgcaggcaaatcaagcttg
atctctgcgatgttggaaaccaacccaacctatgcgatgaaagtctctgtttcacatacc
acacgcggcatgcgcccaggcgaacaagatggtgttcactaccattttgtgcaaaaagag
ctgtttgaagagttgattactaaaggtgaatttctcgaacatgctgaagtatttggcaac
tactacggcacatctaaggtatggattgaaaataacctcaacaaaggcattgacgttttt
cttgatattgactggcaaggcgcgcgtcaaatacgcgacaaaatgcctgaagcaaaaagt
gtgtttatccttccgccttcaaaagaagaattggaacgccgcttgaatgctcgtggtcaa
gacagtgaagccgtcattgctaaacgtatgaatgaagctcaagctgaaatctcgcattac
accgaatacgactatgtcatcataaatgatgatttcgatgtggcattaatggatttcaga
gctattttacgtgctgaacgattgaagcaagacaagcaagctgctaaatataacagcatg
ctcaacgcgctactggcggaataa

DBGET integrated database retrieval system