KEGG   Vibrio anguillarum 775: VAA_00642Help
Entry
VAA_00642         CDS       T01536                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
van  Vibrio anguillarum 775
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VAA_00642
Enzymes [BR:van01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     VAA_00642
Transfer RNA biogenesis [BR:van03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    VAA_00642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:38110..38943
Genome map
AA seq 277 aa AA seqDB search
MMMPTANNLSYLLPDVIEIARSAGQLILDIYEKKNYEAFTKSDHTPVTSADLAAHKLICE
RLSELTPDIPVLSEEAADISLEKRSQWQRYWLVDPLDGTQEFIARSGDFATIIALIEENQ
PVMGVVYGPVSGVTYYAYAGKGAWKIPDMSESLRIETHKHETVGQSIAIAISRRQDINRI
TSCMSSAWNYELVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILN
TQLQPLSYNERETLENPNFIVLGDADLPWNTILQVKP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatgccaacagccaataatttatcttacttactgcctgacgtaattgaaatcgct
cgctctgccgggcaattgattctcgatatctacgaaaagaaaaactacgaagcgttcacc
aaaagtgaccacacccctgtcaccagtgccgatcttgctgcgcataaactgatctgcgaa
cgactgagtgaactcacgccagatattcctgttttgtcggaagaggcggcggacattagc
ctagaaaaacgcagccaatggcagcggtactggttggttgacccgcttgatggtacgcaa
gagtttattgcgcgcagtggtgactttgccaccattatcgcactgatcgaagaaaaccaa
ccagtgatgggcgtcgtctatgggcccgtttctggcgtgacctactacgcctacgcaggc
aaaggcgcatggaagatccccgacatgtctgaaagcttgcgtattgaaacacacaagcac
gaaaccgttgggcaatccatcgcgattgcgatcagtcgccgccaagatattaaccgcatt
acaagttgcatgagcagcgcatggaattatgagctagtgccgctgggctcggcagcgctg
aaagcgtgtttagtcgcagaaggtgctgtcgactgctatttgcgtctcggcccaaccggt
gaatgggataccgccgccacgcaatgcatcgtagaagaggcgggcggacgcatcctcaac
acgcaactacaaccgctgtcctacaatgagcgtgaaacgttagaaaaccccaactttatt
gtgttaggggatgctgatttgccttggaataccattttacaagtcaaaccataa

DBGET integrated database retrieval system