KEGG   Vibrio anguillarum 775: VAA_00642Help
Entry
VAA_00642         CDS       T01536                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
van  Vibrio anguillarum 775
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:van00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:38110..38943
Genome map
AA seq 277 aa AA seqDB search
MMMPTANNLSYLLPDVIEIARSAGQLILDIYEKKNYEAFTKSDHTPVTSADLAAHKLICE
RLSELTPDIPVLSEEAADISLEKRSQWQRYWLVDPLDGTQEFIARSGDFATIIALIEENQ
PVMGVVYGPVSGVTYYAYAGKGAWKIPDMSESLRIETHKHETVGQSIAIAISRRQDINRI
TSCMSSAWNYELVPLGSAALKACLVAEGAVDCYLRLGPTGEWDTAATQCIVEEAGGRILN
TQLQPLSYNERETLENPNFIVLGDADLPWNTILQVKP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatgccaacagccaataatttatcttacttactgcctgacgtaattgaaatcgct
cgctctgccgggcaattgattctcgatatctacgaaaagaaaaactacgaagcgttcacc
aaaagtgaccacacccctgtcaccagtgccgatcttgctgcgcataaactgatctgcgaa
cgactgagtgaactcacgccagatattcctgttttgtcggaagaggcggcggacattagc
ctagaaaaacgcagccaatggcagcggtactggttggttgacccgcttgatggtacgcaa
gagtttattgcgcgcagtggtgactttgccaccattatcgcactgatcgaagaaaaccaa
ccagtgatgggcgtcgtctatgggcccgtttctggcgtgacctactacgcctacgcaggc
aaaggcgcatggaagatccccgacatgtctgaaagcttgcgtattgaaacacacaagcac
gaaaccgttgggcaatccatcgcgattgcgatcagtcgccgccaagatattaaccgcatt
acaagttgcatgagcagcgcatggaattatgagctagtgccgctgggctcggcagcgctg
aaagcgtgtttagtcgcagaaggtgctgtcgactgctatttgcgtctcggcccaaccggt
gaatgggataccgccgccacgcaatgcatcgtagaagaggcgggcggacgcatcctcaac
acgcaactacaaccgctgtcctacaatgagcgtgaaacgttagaaaaccccaactttatt
gtgttaggggatgctgatttgccttggaataccattttacaagtcaaaccataa

DBGET integrated database retrieval system