KEGG   Vibrio anguillarum 775: VAA_00737Help
Entry
VAA_00737         CDS       T01536                                 

Definition
DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
van  Vibrio anguillarum 775
Brite
Enzymes [BR:van01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VAA_00737
Secretion system [BR:van02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VAA_00737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2720929..2721702)
Genome map
AA seq 257 aa AA seqDB search
MSVLRQLTLLTLPLFAVACNAETTEQVTSTAVQAAALDKTVFEQRFSKLGLEVLSVQASD
IPGVIEVQTSGGVLFSAPDASHFIAGTLYELDKNGGYVDVLAKRQAPVNAAKIAQFESSM
IEYKAANEKYVVTVFTDITCGYCTRLHSQMKGYNDLGITVRYMAYPRQGVTGQVADQMAA
IWNADDKMAAMNEAKTNHKLPEAGQNIQQAKQLITKHYQLGRELGINGTPAIFLPNGEMV
GGYLPPEQLLQRLQQIQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgccaactgactcttcttacattgccactttttgctgtggcgtgtaac
gccgaaaccacagagcaagtgacgtcaacggctgtgcaagcggctgcgcttgataaaacg
gtttttgaacaacgtttttctaaactcggattggaagtgctgagtgttcaagcctctgat
attccgggggttattgaagtgcaaacttccggtggtgtgctgttttctgcgcctgacgcg
agccattttatcgccggaaccttgtatgaattagataagaatggtggttatgtcgatgtg
ttagccaaacgccaagcgcccgttaatgcggcgaagatcgcgcagtttgaatcgagtatg
atcgaatacaaagccgccaatgaaaaatacgtggtgactgtttttactgatattacctgt
ggttattgcactcgtttgcatagtcaaatgaaagggtataacgacctagggatcaccgtg
cgctacatggcttacccgcgccaaggcgttacggggcaagtagctgatcagatggccgct
atctggaatgcagatgataaaatggcagcgatgaatgaggcaaaaaccaatcataagttg
ccagaagcaggacagaacattcaacaggctaagcagttgattaccaaacactatcagctc
gggcgtgagttaggcatcaacggcacgcctgcgattttcctaccgaatggcgaaatggtt
ggcggttatttaccaccagagcaattgttgcaacgccttcagcagattcaataa

DBGET integrated database retrieval system