KEGG   Vibrio anguillarum 775: VAA_00741Help
Entry
VAA_00741         CDS       T01536                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
van  Vibrio anguillarum 775
Pathway
van00010  Glycolysis / Gluconeogenesis
van00020  Citrate cycle (TCA cycle)
van00620  Pyruvate metabolism
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01120  Microbial metabolism in diverse environments
van01130  Biosynthesis of antibiotics
van01200  Carbon metabolism
Module
van_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAA_00741
   00020 Citrate cycle (TCA cycle)
    VAA_00741
   00620 Pyruvate metabolism
    VAA_00741
Enzymes [BR:van01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VAA_00741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEH34085
UniProt: F7YPI4
Position
I:complement(2713286..2715169)
Genome map
AA seq 627 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVSVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVSTGSLIMIFEAEGAAVAAPAVEAAPVAAPAAAAVAELKEVHVPDIGGDEVEVTEI
MVAVGDSIAEEQSLLTVEGDKASMEVPAPFAGVLKEIKVAAGDKVSTGSLVMIFEVVGSA
PAAASAQVAVPVAAAPAVSAAKEIHVPDIGGDEVEVTEIMVAVGDTVSEEQSLITVEGDK
ASMEVPAPFAGVVKEIKVAAGDKVSTGSLIMVFEVAGAAPVAVAAPAQAAAPAASAPKAE
AVKSAVAAPAEFEENNEYSHASPVVRRIAREFGVNLAKVKGSGRKSRILKEDVQNYVKEA
LKRLESGSAAVASGKGDGAALGLLPWPKVDFSKFGDTEVKPLSRIKKISGANLHRNWVMI
PHVTQWDNADITELENFRKEQNAIEAKNDTGMKITPLVFIMKAVAKALEAFPSFNSSLSE
DGESLILKKYVNVGIAVDTPNGLVVPVFKDVNKKGIYELSRELAEVSKKARAGKLTAADM
QGGCFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEFKPVWNGKEFEPRLQLPLSLSYDH
RVIDGAEGARFITFLNGALSDIRRLVL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaattaatgtaccggatattggtgcggatgaggttgaagttactgagatt
cttgtcagcgttggcgacaaggttgaagaagagcaatctcttattactgtagaaggtgat
aaggcttctatggaagtaccagcttctcaagcgggtattgtaaaagaaatcaaagtagtc
gctggcgataaagtatcgaccggttcacttatcatgatttttgaagcagaaggcgctgcg
gtcgcagctccagcagtggaagctgcaccagttgcggctcctgctgccgcggctgtcgct
gagcttaaagaagttcacgtgccagatatcggcggtgatgaagtggaagtcactgaaatc
atggtcgcagtcggcgattcaatcgcagaagagcaatctctactgacggttgaaggtgac
aaagcctcaatggaagtacctgctccatttgctggtgtactgaaagagatcaaagtggcc
gcgggcgataaagtatcgacaggctcactggtgatgatctttgaagtggtgggttccgct
ccggcggcagcttctgctcaagtggcagtacctgtagctgcagcaccagccgtttcggca
gcaaaagagatccacgtaccggatatcggtggtgatgaagtcgaagtgacggaaatcatg
gtggcggttggcgataccgtgagtgaagagcagtctcttatcaccgttgaaggcgataaa
gcatcaatggaagttcctgcgccgtttgctggtgttgtgaaagaaattaaagtggcggct
ggtgataaggtgtcaacaggctctcttatcatggtgtttgaagttgccggtgcagcgccc
gttgccgtagcggcccctgcgcaagcagcggctccagccgcatcagcgccaaaagcggaa
gcggtaaaatcagcggtggcagcacctgccgagtttgaagagaacaatgagtactctcac
gcatcaccggttgtacgccgtattgcgcgtgaatttggtgttaacctagcgaaagtcaaa
ggttctggccgtaagagccgcatcctaaaagaagacgtgcaaaactacgtgaaagaagcg
ctgaagcgtcttgaatcgggttctgccgcagtggcttctggtaaaggtgatggcgccgcg
cttggcttgctaccttggccaaaagtggacttcagcaagtttggtgacacagaagtaaaa
ccgctttcacgtattaagaagatctctggtgctaacttgcatcgtaactgggtgatgatc
ccacacgttacccaatgggataatgcggatatcaccgagcttgagaacttccgtaaagag
caaaatgcgattgaagcgaagaacgacactggcatgaagatcaccccactggtgttcatc
atgaaagcggtagcgaaagcactagaagcattcccatcgtttaactcttcactttctgaa
gatggcgaaagcttgattctgaagaagtacgtgaacgtgggcattgctgttgatacgcca
aatggtcttgttgttcctgtcttcaaagatgtgaacaaaaaaggcatttatgagctatca
agagagctggctgaagtatcgaagaaagcccgtgcaggtaaactgaccgctgcagacatg
caaggtggctgtttcactatctctagcttaggtggcatcggcggtacagcgtttacgcct
atcgttaacgcgccagaagttggtatccttggggtatctaagtctgagtttaagccagtg
tggaacggtaaagagttcgaaccacgcctacaactgccactatcactgtcatacgatcac
cgtgtgattgatggtgcggaaggtgcgcgtttcatcacattcctaaatggcgcgctatca
gacattcgtcgtctggttctgtaa

DBGET integrated database retrieval system