KEGG   Vibrio anguillarum 775: VAA_00818Help
Entry
VAA_00818         CDS       T01536                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
van  Vibrio anguillarum 775
Pathway
van00071  Fatty acid degradation
van00280  Valine, leucine and isoleucine degradation
van00281  Geraniol degradation
van00310  Lysine degradation
van00362  Benzoate degradation
van00380  Tryptophan metabolism
van00410  beta-Alanine metabolism
van00640  Propanoate metabolism
van00650  Butanoate metabolism
van00903  Limonene and pinene degradation
van00930  Caprolactam degradation
van01040  Biosynthesis of unsaturated fatty acids
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01120  Microbial metabolism in diverse environments
van01130  Biosynthesis of antibiotics
van01200  Carbon metabolism
van01212  Fatty acid metabolism
Module
van_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VAA_00818
   00650 Butanoate metabolism
    VAA_00818
  Lipid metabolism
   00071 Fatty acid degradation
    VAA_00818
   01040 Biosynthesis of unsaturated fatty acids
    VAA_00818
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAA_00818
   00310 Lysine degradation
    VAA_00818
   00380 Tryptophan metabolism
    VAA_00818
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VAA_00818
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VAA_00818
   00281 Geraniol degradation
    VAA_00818
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAA_00818
   00930 Caprolactam degradation
    VAA_00818
Enzymes [BR:van01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VAA_00818
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VAA_00818
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VAA_00818
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VAA_00818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEH31830
UniProt: F7YHW0
Position
I:complement(243362..245533)
Genome map
AA seq 723 aa AA seqDB search
MIYQANTLQVKELQDGIAELRFCSKESVNKLDLATLESLNHALDALKAHQGLKGLILTSD
KESFIVGADITEFLGLFAKPAQELDQWLQFANSIFNKLEDLPVPTLAALTGHALGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGCVRLPRVIGADNAMEVITQGKACRAEEALK
IGLLDAIVDSDKLLESALKTITSAINETVDWKMRRQQKTSALTLSKLEAMMSFTMAKGLV
AQHAGPHYPAPITSVIAIEEAARCSRDEALAIERKHFVKLAHSEAAKSLVGLFLNDQYIK
ALAKKAAKSANKETGRAAVLGAGIMGGGIAYQSAVKGVPVLMKDIAQSSLNLGMTEASKL
LNKQLERGKIDGFKMASVLASITPSLHYAGIEQADVIVEAVVENPKIKAAVLSEVEANVG
EDAVITSNTSTIPINLLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEHTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSLLLRDGADFTQIDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAQGFPERMGKQGRDAIDALFDANKYGQKNGSGFYQYTLDKKGK
PKKTFSEEVLTVLNVECGDKRTFDDQTIIERMMIPMINEVALCLEEKIIASPQEADMALV
YGLGFPPFRGGVFRYLDSLGLQNYVAMASQYQALGAMYHVPQLLLDMAEKGETFYGAQQA
SSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaacaccctacaggtaaaggaattacaagatggtattgcggagttg
cgtttctgctccaaggagtcagtgaacaaacttgaccttgccactcttgaatcgctcaac
catgcacttgatgccctaaaagcccaccaaggactgaaaggccttattcttacttccgat
aaagaatcttttattgtcggggctgatatcactgagtttttaggcctctttgctaaacct
gcgcaagaactcgaccaatggctgcaatttgccaatagcattttcaacaaactagaagat
ctacccgttccgacactagccgctttaacagggcacgcgctaggcggtggatgtgagtgt
gtactcgctaccgatttccgtattggtgacgcgaccaccagcataggattaccggaaaca
aagcttggtattatgccggggttcggtggctgtgtgcgtctgcctcgtgtaattggtgcc
gacaatgctatggaagtgatcactcaaggcaaagcatgtcgtgctgaggaagcccttaaa
attgggctgctcgatgcgattgttgatagcgacaaactgcttgagtcagcactcaaaacc
atcacatcggccatcaatgaaaccgttgattggaaaatgcgtcgccagcaaaaaacgtcc
gcgctgacactcagcaaattagaagccatgatgagcttcaccatggccaaaggcttggtt
gcacagcatgccggacctcattatccagcgccaataacctctgttattgcaatagaagaa
gccgcgcgctgtagccgtgatgaagcattggccattgagcgtaaacacttcgttaagctc
gctcattctgaagcggcgaaatccttggtcggtttattcctcaacgaccaatatattaaa
gcactagcaaaaaaagcggctaaatcagccaataaagaaaccggacgagcggcggtactt
ggtgcggggatcatgggcggcggcattgcttatcaatcggcagtaaaaggcgtgcctgtt
ttgatgaaagatattgctcaatcgtcccttaatttaggtatgaccgaggcatctaagtta
ctcaacaagcagctagagcgcggaaaaattgatggttttaaaatggccagtgtgctggca
tcgattacgcctagcctgcattatgcggggattgagcaagcggatgtgattgttgaagct
gtggttgaaaacccgaaaatcaaagccgcggtactaagtgaagtcgaagccaatgttggt
gaggatgcggttatcacctcgaacacctcaaccattccaatcaacctactggccaaatca
ctcaaacgtccagaaaacttctgtggtatgcacttttttaacccagtacatcgtatgcca
ttggtggaaattattcgtggtgaacacacttccgatgaaaccatcaatcgagttgtcgct
tacgcggccaaaatgggtaaatcccccatagtggtcaatgactgccctgggttcttcgta
aaccgcgtacttttcccttactttggtggctttagtttattactgcgcgatggcgctgat
ttcactcaaatcgataaagtgatggaacgtaagtttggttggccaatgggccctgcttat
cttctagatgtggtcggtattgataccgctcaccatgcacaagcagtaatggcacaaggt
ttccccgaacgtatgggtaaacagggccgcgatgctattgatgcactgtttgacgccaat
aaatatggccagaaaaatggcagcggtttctatcaatacactttagataagaaaggcaaa
ccgaagaaaactttctctgaagaggtcctcactgttcttaacgtagaatgtggtgataaa
cgtacttttgatgatcaaactatcattgagcgcatgatgattccgatgatcaatgaagtg
gcactctgtttagaagagaagatcatcgcctcaccccaagaagcggatatggcgttggtg
tacggcttggggttccctccttttagaggcggcgtattccgctatctcgatagtcttggt
ttacaaaactacgttgcaatggcaagccaataccaagcattgggcgcgatgtatcatgta
cctcaactgctgcttgatatggcagaaaaaggcgagaccttctacggtgctcaacaagca
agttctatctaa

DBGET integrated database retrieval system