KEGG   Vibrio anguillarum 775: VAA_01061Help
Entry
VAA_01061         CDS       T01536                                 

Definition
Acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
van  Vibrio anguillarum 775
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VAA_01061
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VAA_01061
Enzymes [BR:van01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VAA_01061
Lipid biosynthesis proteins [BR:van01004]
 Desaturase
  First
   VAA_01061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(921738..922865)
Genome map
AA seq 375 aa AA seqDB search
MESASKPPLIWINIVIFSFSLGLATIAAPLYGWQFGYGMEHWLWLMICFSFCNLSITAGY
HRLWSHKTYEAHWALRLLFALGGAFALQNSALHWSSDHRVHHKHVDNNDKDPYSAKRGFW
FSHIGWMLRHYNKTTYDDYSNCRDLQKDKIVMWQHKYYVPLALAMNLGVPLILGFIYHDI
LGMLLIVGALRLVLNHHTTFFINSLAHIWGSQPYTDKNTARDNGILAFFTFGEGYHNYHH
IFENDYRNGIYWWQYDPTKWLIKLCSWLGLAGKLRTSPPLKVEKAKALMALSHAQKQIAA
LPNQQLVMASIQREFDALVIQLQEYYELKKQLIESKKNNMVRRYEHSLLMLRYRQVKQQL
ALQKSNWQLIVRQYS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggcatcaaaaccaccacttatctggataaacatcgtcatttttagcttcagc
ttgggcttagcgacgattgcagcccctttgtatggatggcaatttggctacggcatggag
cattggctttggctgatgatttgtttttccttttgcaacctttccattaccgcgggatat
caccgtttatggtcacataaaacctatgaagcacattgggcactgcgattattgtttgca
ttaggtggggcatttgcactgcaaaacagtgcactacattggtcttctgatcaccgagtt
catcacaagcatgtagacaataatgacaaagatccttattcagcaaaacgaggtttctgg
ttttcacacataggttggatgctgcgtcactacaataaaaccacgtatgatgactactcc
aactgccgtgatctgcaaaaagataagatcgtcatgtggcagcataagtattatgtgcct
ttggcactcgcaatgaacttgggcgttcctctgatccttggttttatttatcacgatata
ctgggcatgttactgatcgtgggtgcactgcgtttagtgctcaatcatcacacgacattt
ttcatcaattcgctggctcatatatggggtagccaaccttatactgataaaaatacagcc
cgcgataacggtattttggctttcttcacttttggcgagggctaccacaattatcaccat
atttttgaaaacgattatcgtaatgggatttattggtggcaatacgacccaacaaaatgg
ctgatcaagctgtgttcgtggcttgggttggctggtaaactgcgcacttctcctcccctt
aaggtagaaaaagcgaaagcgttaatggcattaagccatgcgcaaaaacagatcgccgcg
ttacccaatcagcaactcgttatggccagcatacaacgtgaatttgacgctttagtcata
cagttgcaagagtattatgaattaaagaaacagctgatcgaaagtaaaaaaaacaatatg
gttcgtagatatgaacactccctattgatgctgcgctatcgacaagtgaagcaacaatta
gcactacaaaaatccaattggcagcttattgtgcgtcagtactcctaa

DBGET integrated database retrieval system