KEGG   Vibrio anguillarum 775: VAA_01259Help
Entry
VAA_01259         CDS       T01536                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
van  Vibrio anguillarum 775
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:van01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:van00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:van00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(355058..355636)
Genome map
AA seq 192 aa AA seqDB search
MNMLTFDKTEIQKLDKPFIAEAVFAVETISANQQNEKQSRAKQLLDRLFPLATGSHQDVT
SYVIDYRHVLAYFKDGRHSGLKHPKHFVAFNGEKESPCSILFRDGSGSHVEVMLGCTKGT
GRVELIEINDIQLETCTTFTQSVEEMPSAAMRHWVSLVKGDEKGKPQACSEDKEYTAKDG
EDYYLNYSFNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgacattcgataaaacagaaatccaaaaactagataaaccctttatcgct
gaagccgtcttcgccgtcgagactatcagtgctaatcaacaaaatgaaaagcagagtaga
gcgaagcaactactcgatagattgttccctttggcgacgggctctcatcaagatgtgacc
agttatgtgatcgattaccgccatgtgttggcttatttcaaggatgggcgtcatagtggt
ttgaagcacccaaaacattttgttgccttcaatggtgaaaaggagtcaccatgttcgatc
ttgtttcgtgatggaagtggtagccatgttgaagtgatgttaggctgcactaaagggact
ggacgcgttgaactgatagagattaatgatattcagttagaaacgtgtaccacatttacc
caatcggtggaagaaatgcccagcgccgcaatgcgccactgggtaagcctagtcaaaggt
gatgaaaagggtaagcctcaagcttgtagtgaagataaggagtacaccgcaaaagatggt
gaagactactacttaaactacagttttaaccttgcttag

DBGET integrated database retrieval system