KEGG   Vibrio anguillarum 775: VAA_01353Help
Entry
VAA_01353         CDS       T01536                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
van  Vibrio anguillarum 775
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAA_01353
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VAA_01353
Enzymes [BR:van01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     VAA_01353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:456303..457019
Genome map
AA seq 238 aa AA seqDB search
MINHKIFQTPEQVVETLANEMQRYSEQGQPVHISLSGGSTPKMLFKLLASEPYAQAIAWQ
NLHFWWGDERCVAPDDAESNFGEANTLLFSQVNIPPQNIHRIRGEDDPQTEAKRFADEMA
KVIPSVNGTPVFDWILLGVGADGHTASLFPNVTDYEDENLSLVATHPESGQLRVSKTAKV
LEAAKRISYLVLGSGKAEIVHEIHTTKAEDLPYPAAKVKSTTGETEWFLDSDAATKIA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcataaaatttttcaaaccccagaacaggtggttgaaacgctcgccaatgaa
atgcaacgctatagcgagcaaggtcagccagttcatatctccctttccggtggcagcaca
cccaaaatgctgttcaaattattggccagtgaaccttatgcacaggcgattgcatggcaa
aacctgcatttttggtggggtgatgaacgctgtgttgctcctgacgatgccgaaagcaac
tttggtgaagccaatacactgctgtttagccaagtgaacattccacctcaaaatattcac
cgtattcgcggcgaagatgatccacaaaccgaagctaagcgctttgccgatgagatggca
aaagtcattccatccgtcaacggtactcctgtttttgattggattttgctcggtgttggc
gcagatggccatacggcatccctgttccctaatgtgaccgactacgaggatgagaattta
tctttagtggcaacgcatccggaatcaggccaacttcgtgtctctaaaacagcgaaagtg
ttggaagctgcaaaacgcattagttacctcgttcttggctcaggtaaagccgagatcgta
cacgaaattcacaccacgaaagccgaggatcttccttatccggctgccaaagttaaatca
acaactggcgaaacagagtggtttttagattcagatgccgcaacaaagattgcgtga

DBGET integrated database retrieval system