KEGG   Vibrio anguillarum 775: VAA_01419Help
Entry
VAA_01419         CDS       T01536                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
van  Vibrio anguillarum 775
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:van02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:van02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1627400..1628473
Genome map
AA seq 357 aa AA seqDB search
MKKIKVLIVDDSAVVRQVISALLSNEPDIEVLTPASDPIFAQKKMAVQWPDVIILDVEMP
RMDGITFLKQLMAEHPTPVIICSTLTERGAEVTMQALQAGALTIITKPKAGLKDFLQESR
QEMLSAVRAAAQAKLENIVKPKPHVLKKVQQTMPNPNHSTLTLKTTQKVVVIGTSTGGTQ
ALEAILTALPAVSPGIVIVQHMPEKFTAMFADRLNGLCQIEVREAKNGDRVLPGLALIAP
GGRHMQLNRSGAHYQVEIKDGPAVNRHKPSVDVLFRSAAKHVGPNAVGFILTGMGDDGAR
GLHELKESGAYTVAQDEASCIVFGMPKEAIERGGACSVLPLNQIAQEILQRASSRHL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaaagtattaatcgtggatgactccgcggttgttcggcaagtgatcagc
gctttgttgagtaatgaacctgatattgaagtgcttactcccgcttctgatcccatattc
gctcaaaaaaaaatggctgttcaatggccagatgtgattattttagatgtagaaatgcct
cgtatggatggtattacgtttcttaagcaactgatggcggagcatccgacgcctgtcatc
atttgttctacactgacggaacgtggtgcggaagtgactatgcaagcattgcaagcgggt
gcgttgacgattatcactaaacccaaagcagggttgaaagattttctacaagaaagtcgg
caggaaatgttaagtgcggtgcgcgccgccgcacaagcaaagctagaaaatattgttaaa
cccaaacctcatgtactcaagaaagtacagcaaacaatgccgaatccgaatcactcgaca
ttaacattgaagaccacacaaaaagtggtcgtgatcggcacatctacaggtgggacacaa
gctttagaagcgatcttaacagcattgccagcagtctctccggggattgttatcgtgcaa
catatgcccgaaaaatttaccgcgatgtttgctgaccggctcaatgggctttgtcaaata
gaggtcagggaagcaaagaatggcgaccgagttcttccggggttggcattgatcgctccg
ggtggccgtcacatgcaactgaatcgaagtggtgcacattatcaagtcgaaatcaaagat
ggccccgcagttaacaggcataaaccatcagtcgatgtactttttcgctcagcggcaaag
catgtaggccctaacgctgtcggttttattttgacgggaatgggagatgatggcgcacga
ggtttgcatgagttgaaagagagcggtgcctatacagttgcacaagatgaagcaagctgt
atcgtttttggtatgcccaaagaggcaatcgaacgtggtggtgcttgttcggtgctacca
ctcaatcaaatagcgcaggaaatattgcaacgagcttcatcgaggcacttgtag

DBGET integrated database retrieval system