KEGG   Vibrio anguillarum 775: VAA_01502Help
Entry
VAA_01502         CDS       T01536                                 

Definition
Acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
van  Vibrio anguillarum 775
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:van01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:216327..216827
Genome map
AA seq 166 aa AA seqDB search
MPIENAWPSLLPNALQAEGKSDIDVINASISGDTTGNGLARLPSLLTLHTPDAVLIELGA
NDGLRGFPPQLISSNLTAIIGQIKKAGSTPLLMQIRIPPNYGKRYSDAFYSLYSELSLQH
TVPLLPFFLEQVIIKPEWMMADGLHPTVDAQPWIANFVAQHLAEHL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgaaaacgcttggcctagcttgctacctaatgcgttgcaagctgaaggtaaa
tcagacattgatgtcattaatgccagtatttctggcgatacaacgggcaatggcctagcc
cgcttaccgtcactactcaccctgcatacccctgatgcggtgcttattgagcttggtgcg
aacgacggattgcgtggctttccacctcaattgatcagcagcaatttaaccgccattatt
ggccaaataaaaaaagcaggctcaacccctcttttgatgcagattcgcattccaccaaat
tatggcaaacgctacagcgatgccttttatagcctctattctgagcttagcctccaacac
actgtgccgttgctgccttttttcttagagcaagtgatcattaaacccgagtggatgatg
gccgatggcttacatccgacggtcgacgctcagccgtggatcgccaattttgttgcgcaa
catttagcagagcatctctga

DBGET integrated database retrieval system