KEGG   Vibrio anguillarum 775: VAA_01539Help
Entry
VAA_01539         CDS       T01536                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
van  Vibrio anguillarum 775
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VAA_01539
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VAA_01539
Exosome [BR:van04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAA_01539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(171490..173082)
Genome map
AA seq 530 aa AA seqDB search
MSKLTSKITITLHKTINVKDKEKTMTEQKYIVALDQGTTSSRAVVLDHDANIVSVSQREF
TQIYPQAGWVEHDPLEIYATQSSTLVEALGKAGIRSDEIAAIGITNQRETTVVWNKETGK
PVYNAIVWQCRRTASICEELKARPGLEEYIRENTGLVLDPYFSGTKIKWILDNVEGARQD
AEAGKLLFGTIDSWLVWNMTQGRVHVTDYTNASRTMLFNINNLHWDEKILKEFDIPLSMM
PEVKKSSEVYGQTNIGGKGGTRIPIAGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMN
TGKEKVTSHNGLLTTLACGPAGEPHYALEGAVFMGGASIQWLRDELKLISDAHDSEYFAT
KVDTANGVYVVPAFTGLGAPYWDAYARGTIVGLTRGVNSNHIIRATLESVAYQTRDVLDA
MQADSGIKLSALRVDGGAVANNFLMQFQSDVLDTEVHRPKVTEVTALGAAYLAGLAVGFW
GSLDELADKAVIDKTFVPHQDEEKRDRRYKGWKRAVKCAQAWATMHDDEE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagctcacgtctaaaataacgataacacttcataaaacgattaacgtgaaagat
aaggaaaagaccatgactgagcagaaatatattgttgcccttgaccaaggaacaacaagc
tcacgtgctgtagtgttagatcatgatgctaacattgtcagtgtttctcagcgtgaattt
acccagatctaccctcaagctggctgggttgaacatgatccactggaaatttatgcgacg
caaagttcgacgctagtagaagcacttggcaaagctggtattcgcagtgatgaaattgcg
gcgattggtattaccaaccaacgtgaaactacggtggtgtggaacaaagaaacgggtaaa
ccagtctacaatgcgattgtatggcaatgtcgacgtaccgcatccatttgtgaagaattg
aaagcacgcccagggctcgaagagtacattcgcgaaaatacaggcctagtgcttgaccct
tacttctctggcaccaaaatcaaatggattttggataatgtcgaaggggctcgtcaagac
gccgaggctggaaaactgctgtttggtacaattgactcgtggctcgtttggaacatgaca
caaggccgtgttcacgttacggattataccaatgcatctcgcactatgcttttcaatatc
aacaacttgcattgggatgagaaaatcctaaaagagtttgatattcctttgtctatgatg
cctgaagtgaagaaatcttccgaagtttacggccaaaccaacattggtggtaaaggcggg
acacgtattcctattgctggaattgcgggtgaccagcaagctgcgctttatgggcagatg
tgtgttgaggcgggccaagcaaaaaatacttacggcactggctgtttcttattgatgaac
acaggtaaagagaaagtcacctcacataatggcttgctaaccactctagcttgtggccct
gctggtgaacctcactacgcgcttgaaggtgcagtctttatgggcggtgcatcgattcaa
tggttgcgtgatgaattgaaactgatttcagatgcgcatgactcagaatatttcgctacg
aaagttgatacggccaacggcgtttatgttgtgccagcgtttactggtttaggcgcgccg
tattgggatgcttatgcccgtggtacgattgttggtttaacgcgtggcgtgaattcgaac
catattattcgtgcgaccttggaaagtgtcgcttaccaaacacgtgatgtacttgatgca
atgcaagctgattctggcatcaaactgtcagcattacgcgtagacggtggcgcggtagcc
aataatttcttaatgcaattccaatcagatgtgcttgataccgaagtacaccgtcctaaa
gtgacggaagtgaccgcgctaggagcagcctatttagctggtcttgcggttggcttttgg
ggaagcttggatgagcttgctgataaagccgtgatcgataaaacattcgttcctcatcaa
gatgaagagaagcgcgatcgtcgctataaaggttggaaacgtgcggtgaaatgtgctcaa
gcttgggcaactatgcacgatgacgaagagtaa

DBGET integrated database retrieval system