KEGG   Vibrio anguillarum 775: VAA_01627Help
Entry
VAA_01627         CDS       T01536                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
van  Vibrio anguillarum 775
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:van00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(78211..78864)
Genome map
AA seq 217 aa AA seqDB search
MLGLSESAKLVKDALESRGLETPMRPNEVTREEKKEKIEHHMREILTLLGLDLTDDSLEE
TPHRIAKMYVDEVFSGLDYQNFPKITVIENKMNVSEMVRVKEITVTSTCEHHLVTIDGKA
AVAYIPRGKIIGLSKINRIVRFFAQRPQVQERMTQQILVALQTLLGSDDVAVTIDATHYC
VKSRGVMDATSETTTTALGGIFKSNPATRAEFFHGLH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtcttagcgaatcagcaaagttggtcaaagatgcgctagagagccgaggtttg
gaaacgcctatgcgtccaaatgaggttactcgtgaagaaaagaaagaaaaaatcgaacac
catatgcgtgagatcctcacactactcggtcttgacctgaccgacgacagtttagaagag
acgccccatcgaattgcgaaaatgtatgtggatgaagtgttttctggcctcgattatcaa
aacttccccaaaattactgtgatcgaaaacaagatgaacgtcagtgaaatggtgcgcgta
aaagagattaccgtgaccagcacctgtgagcatcatctagtgactatcgatggtaaagcc
gcggtggcgtatatcccaagaggcaagataattggtctttctaagattaaccgtattgta
cgtttttttgctcagcgcccccaagttcaagagcgaatgacacagcagattctggtggct
ttgcaaaccttactcggttcggacgatgtcgcggtcaccattgatgccactcattactgc
gttaagtcacgtggtgttatggatgcgaccagtgaaacgaccaccacagcattaggcggt
atttttaaatctaaccctgccacccgcgccgaatttttccatggtttacattaa

DBGET integrated database retrieval system