KEGG   Vibrio anguillarum 775: VAA_01741Help
Entry
VAA_01741         CDS       T01536                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
van  Vibrio anguillarum 775
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VAA_01741
   00052 Galactose metabolism
    VAA_01741
   00500 Starch and sucrose metabolism
    VAA_01741
   00520 Amino sugar and nucleotide sugar metabolism
    VAA_01741
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VAA_01741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2969196..2970065
Genome map
AA seq 289 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQAGMTGMCIVTGRGKH
SIMDHFDKNYELEHQISGTNKEELLVDIREIIDTANFTYIRQREMKGLGHAILTGRELVG
DEPFAVVLADDLCVNQEKGVLAQMVALYKQFRCSIVAVQEVPENETHKYGVISGEMIKDD
LFRVDDMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAQSG
CVLAYKFKGQRFDCGSVEGYIEATNYCFENMYKKNEQKVALDKHSTHKA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcctattcccagccgctggctacggtacacgttttcttccagcgacc
aaatcaatgcctaaagagatgatgccagtcgtcaataaacccttgatcgaatatggtgtt
gaagaggcgattcaagctggaatgaccgggatgtgtattgtgactgggcgtggaaaacac
tcgatcatggatcacttcgataaaaactatgagctagagcatcaaattagtggcaccaac
aaagaagagctactggttgatattcgtgaaatcattgataccgccaacttcacctacatt
cgtcaacgtgaaatgaaaggtttaggccatgcgattttaacgggtcgagagttagtcggc
gatgaaccttttgcggtggtgctggccgatgacttatgtgtcaatcaagaaaaaggggtt
ttggcacaaatggtcgctctgtataaacagttccgctgctcaattgttgccgttcaagaa
gtgcctgaaaatgaaacacataaatacggtgttatttccggtgaaatgatcaaagacgat
ctgttccgagtggatgacatggttgaaaaaccagaaccaggcaccgcaccaagcaattta
gccatcattggtcgctacattttaaccccagatatttttgatctgattgagcaaacagag
ccgggtaaaggtggcgaaattcaaattaccgacgcgctactcaaacaagcgcaatcaggc
tgtgtattggcgtataaattcaaaggccaacgctttgactgtggtagcgtagaaggctat
atagaagccactaactactgctttgaaaacatgtacaaaaagaacgaacaaaaagtcgcg
ttggataaacattcgactcataaagcttaa

DBGET integrated database retrieval system