KEGG   Vibrio anguillarum 775: VAA_01940Help
Entry
VAA_01940         CDS       T01536                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
van  Vibrio anguillarum 775
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAA_01940
Enzymes [BR:van01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VAA_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(474608..476818)
Genome map
AA seq 736 aa AA seqDB search
MKGKEVPSEKAMKQLNALKQVAAMANIADSYISAWGDEAKVEDETIIRLLASLGYDTTND
ETLLKSAEKKHKKDVLDPVLVIREGEAVEVPLYLGASARESEFNWRLETEQGEVLEGYLQ
SQVVRDERAEGGPLVFALPSDLAWGYHKLLVTRKRRKTPYELTLIVTPKACYKQAPIIEG
KKLWGPSVQLYTLRTQHNWGIGDFGDLKQLVADIASRGGDFVGLNPIHSLFPANPEGASP
YSPSSRRWLNILYIDVSSVPEFALSADAQQKVGSAEFQQRLQKVREAHWVNYTEVATLKM
SVLPLLFTEFKKRHLDKNSDRAQAFLNFVEEGGESLVHQAAFDALHVDLHAQDPNVWGWP
VFPEKYRRFENSAVQKFIEDNQDKVHLYMYLQWIADGQINEAQALAEEKGMAVGLYRDLA
VGVADSGSETWADAGNLILDASIGAPPDILGPLGQNWGLPPLNPQVLQATAYDAYIKLLR
ANMKHCGALRIDHVLGLLRLWWVPKGENATKGAYIYYPVQDMLAILALESHRHQCSVIGE
DLGTVPDEIVDILADAGVHSYKVFFFETAEDGGFISPKHYAAQSMSALCTHDMPTLRGFW
HCDDLKMGSEIGLYPDQAQLEALFEDRLKCKQGILDSVAWHGYLPEGVGRDASLVPMDSY
LSEALQLHVASGASTLLSIQLEDWLEMDKPVNIPGTVNEYPNWRRKLSMNLDEVFARDNV
NRIAARLTEVRASVSK
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggggaaagaagtcccttcggagaaagcgatgaaacaactaaacgcattaaaacaa
gtagcggcgatggcgaacattgccgacagctacataagcgcgtggggcgacgaagcgaaa
gtggaagatgaaaccattatccgcttattggcgtctttgggctatgacacaaccaatgat
gaaacgctgctgaaatcagcagaaaagaaacacaagaaagatgtattggatcctgttctc
gttattcgtgaaggtgaagcggtggaagtgccactttatctaggtgccagcgcacgtgaa
agcgaatttaactggcgcttagaaaccgagcaaggagaggtacttgaaggctatcttcaa
tcgcaagtcgttcgtgatgaacgcgctgagggtggccctttagtgtttgcattgccaagc
gatttggcatggggatatcacaaactgttggtgacacggaaacgccgtaaaacaccgtat
gagctcacgctgatagtgacgccaaaagcctgttacaaacaagcacctattattgaaggt
aaaaaattgtggggcccgagtgtgcagctttacacgctgcgtactcagcacaactggggt
attggtgattttggcgacttaaaacagttagtggcggatattgcctctcgtggcggcgat
tttgtcggccttaacccgattcattctctctttcctgcaaacccggaaggggcgagtcct
tacagcccatcgtcacgccgttggctcaatattttatacattgacgtgagttcagtgcct
gaatttgctttgagtgcggatgcgcagcaaaaagtaggcagtgcggagtttcagcaacgt
cttcagaaagtacgtgaagcgcattgggtaaactacaccgaagttgcaacattaaaaatg
agtgtcttgccactcctgttcaccgaatttaaaaaacgccatttagataaaaatagcgat
cgcgcacaagcctttttgaatttcgttgaagaaggtggtgagagcttagtgcaccaagcg
gcattcgatgcgctgcatgtcgatttacatgcccaagatccgaatgtatggggttggccg
gttttccctgaaaaatatcgtcgttttgaaaacagcgcagtacagaaatttatcgaagac
aatcaagataaagttcacctatacatgtacttgcagtggattgctgatggccaaattaat
gaagcccaagcactcgcggaagaaaaaggcatggcggtcggcttataccgcgaccttgcg
gtgggtgtggctgattcaggctctgaaacttgggctgatgccggtaacttgattttagac
gccagcattggcgcaccgcccgatattcttggaccactgggtcaaaattggggcttacca
ccgcttaatccacaagtattacaagcaaccgcttacgatgcttatatcaagctgctgcgc
gccaatatgaaacattgtggtgcgctgcgcattgaccatgtacttggtttactgcgtttg
tggtgggtaccaaaaggtgaaaatgccactaagggtgcttatatctactacccagtacaa
gatatgctcgcgattttagcgttggaatctcaccgccatcaatgcagcgtgattggcgaa
gatttgggtacagtacccgatgaaatcgtcgatattttagccgatgcgggtgttcactct
tataaagtgttcttttttgaaaccgcagaagatggcggctttatctcaccgaaacattac
gccgctcaatcgatgtcggcactgtgcacacatgatatgccaacgttgcgtggtttctgg
cattgcgatgatctcaaaatggggagcgaaattggtttgtaccccgatcaagcccagctc
gaagccttgtttgaggaccgtttgaaatgtaaacaaggcattttggattcggtggcatgg
catggttatttgcctgagggtgtggggcgcgacgcaagccttgttccaatggattcatat
ttaagtgaggcgctgcaactgcacgttgcatctggtgcatcgaccttgttaagtattcag
ttagaagattggttggaaatggataaacccgttaatattccgggcaccgttaatgagtac
cctaactggcgtcgtaaactttcaatgaatttggatgaagtatttgcgcgtgataatgtc
aatcgcattgctgcacgtttaacggaagtgcgagcgagtgtaagtaaataa

DBGET integrated database retrieval system