KEGG   Vibrio anguillarum 775: VAA_01950Help
Entry
VAA_01950         CDS       T01536                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
van  Vibrio anguillarum 775
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VAA_01950
Enzymes [BR:van01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VAA_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:146175..146936
Genome map
AA seq 253 aa AA seqDB search
MTVLVTRPENQGIELCQQLADLGIRSVHHPLIQINAGADLPYLLPELQQCDIIIAVSQNA
VTFSHQFLQDHRYFWPNDARYLAVGQKTAHVFSKLSQQKVHYPQISDSEHLLALPQLQSI
SGLKVMILRGNGGRELIHDSLIERGADVVYKEVYRRDTITLFAAESISLWQQQQVTQLVV
TSSGQLNFMMDQFSDSQRLWLLNLALFVPSERIRQEALHMGFGCVTNVGSASNTELAASI
SQSRQDSKHDKQK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgttggtcactcgccccgaaaatcaagggattgaactttgccaacaattagcg
gatctcggtatccgctccgttcaccatccactgattcagattaatgcaggagccgatctc
ccgtatttactcccagaacttcagcaatgcgacattattattgcggttagccaaaacgcg
gtgacgttcagtcatcaatttttgcaagatcaccgatatttttggccaaatgacgccaga
taccttgccgttggtcaaaaaaccgcacatgttttcagcaaattaagccaacaaaaagta
cactatccgcagataagtgacagtgaacacctgcttgccctaccgcagttgcaatcaata
tcgggccttaaggtgatgattttacgtggtaatggcggacgtgagctcatccacgacagc
ttaatcgagcgtggtgctgatgtggtgtataaggaagtgtatcgacgtgatacgatcacc
ctctttgccgccgaatcgatatctctgtggcagcaacagcaagtcactcagttagttgtc
accagctcaggtcaactcaattttatgatggatcaattctctgattcacaacgactctgg
ctgctaaatttagctctttttgtcccaagcgagcgaattcgacaagaggcgctgcacatg
ggatttgggtgcgtcacgaacgtgggaagcgcctccaatacagaactcgcggctagtatt
agccaatctagacaggactctaagcatgacaagcaaaaataa

DBGET integrated database retrieval system