KEGG   Vibrio anguillarum 775: VAA_01963Help
Entry
VAA_01963         CDS       T01536                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
van  Vibrio anguillarum 775
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VAA_01963
Enzymes [BR:van01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VAA_01963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:133539..134549
Genome map
AA seq 336 aa AA seqDB search
MNQTSPNSPPYTQESFFEQVINTTIADFWHSREEGFIKSADKTKLYWCKLTSPQHSKAIF
VVNGRIESCWKYQELFYDFFQQGYDIYSFDHRGQGLSDRLIDDPQIGHVGEFDDYILDMQ
RVIEHFDLSHYAQRFLVAHSMGGAIATRYVQTYPQHPFAAMVLSAPMFGVNMPWQLRPIA
MTLSQVLTAMYSKPTYAPGYQAYSAKPFEINPLSQSQVRYQWFRDLYQRKPELQVGGPST
RWVWQGLMAAKLCQLMTRQVKLPTLILQAGQDDIVSNADQIRFVTKLAKTNPSSKLVIIE
GAKHELFFEKDCYRNQALDELFKQFQSLENTVKSRC
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagacgagtccaaactccccaccttatactcaagagtctttctttgagcaagtg
atcaataccacgattgccgatttctggcactccagagaagaaggttttatcaaatctgct
gataaaacaaaactttattggtgcaaacttacctcgcctcaacactcaaaggcgatcttc
gtcgtcaacggacgaattgaatcttgctggaaatatcaggagctattctatgattttttc
caacaaggttatgatatttattcttttgatcaccgtggccaagggctttctgatcgatta
atcgacgatccacaaatcggccatgtcggtgaatttgatgactacattttagacatgcag
cgtgtcattgagcactttgacttaagccattatgcacaacgttttctcgtcgcccactcg
atgggcggtgccattgcgacccggtatgtacaaacataccctcaacacccatttgcggct
atggtgctcagcgcgccaatgtttggtgtcaacatgccatggcaattacgtcctatcgcc
atgacgctgagccaagtgctgacggcgatgtatagcaagccaacctatgcgccaggctat
caagcctattcggcaaagccttttgagattaacccattaagtcaaagtcaggtgcgttac
caatggtttcgagacctgtaccaacgcaaacccgaattgcaagtcggcggccctagcacg
cgctgggtatggcaagggctcatggcagcgaagctgtgccaactgatgactcgtcaagtg
aagttaccaacactcatcttgcaagcaggacaggatgacattgtcagtaatgcggatcaa
attcgctttgtcactaagctggcgaaaaccaatccatctagcaagctggtcatcattgaa
ggagcaaagcatgagctcttttttgaaaaggattgctatcgaaaccaagcacttgatgag
ctatttaagcaattccaatctcttgagaacacagttaaatcaagatgttag

DBGET integrated database retrieval system