KEGG   Vibrio anguillarum 775: VAA_02105Help
Entry
VAA_02105         CDS       T01536                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
van  Vibrio anguillarum 775
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAA_02105
Enzymes [BR:van01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VAA_02105
Peptidases [BR:van01002]
 Cysteine Peptidases
  Family C44
   VAA_02105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2271892..2273556
Genome map
AA seq 554 aa AA seqDB search
MCSIFGILDIKSDATALRPIALEMSKKMRHRGPDWSGIYASEKAILAHERLSIVGLNSGA
QPLYSPNKKHILAVNGEIYNHKEIRARYQGKYDFQTDSDCEVILALYADMGAALLEELNG
IFAFVLYDEEKDEYLIGRDHIGIIPLYQGHDEHGNYYIASEMKALVSICKTISEFPPGSY
YSSKEASAQRYYIRDWNEYAAVQGNSSSKEELKQALEAAVKRQLMTDVPYGVLLSGGLDS
SITSAIAKRYAAMRIEDDEQSEAWWPQLHSFAVGLDGAPDLKAAREVAEKIGTVHHEMTY
TIQEGLDAIRDVIYHIETYDVTTIRASTPMYLMGRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAQEFHEETVRKLLALNLFDCARANKSLAAWGVEGRVPFLDKEFIDVAMRLNPAD
KMCGNGKMEKHILRECFEDYLPASIAWRQKEQFSDGVGYSWIDTLKSVAEEKVTDQQMET
AKYRFPYNTPATKEGYVYREIFEELFPLESAAQCVPGGPSVACSSAKAIEWDESFKNCID
PSGRAVKAVHNEAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatatttggcattcttgatattaaaagtgatgcaacagcgttacgcccaata
gcgctagagatgtctaaaaaaatgcgtcaccgcggccctgactggtctggcatctatgct
tcagaaaaagcaatcttggctcatgagcgcctttctattgtcggtttaaacagcggcgca
caaccactttacagcccaaataaaaagcacatattagcggtcaatggtgagatttataac
cacaaagaaattcgtgctcgttaccaaggcaaatacgattttcaaaccgactctgactgt
gaagtgatattagcgctttatgcagacatgggtgccgcgctgcttgaagaactcaacggc
atctttgcctttgtgctctatgatgaagaaaaagatgagtacctcatcgggcgtgaccat
attggtatcattcctctttaccaaggccatgacgaacacggtaactactacattgcatcc
gaaatgaaagctttggtaagcatttgcaaaactatcagtgaatttcctcctggtagttac
tacagctcgaaagaggcaagcgcacagcgctactatattcgagattggaatgaatatgcg
gcagtccaaggcaatagcagcagtaaagaagagctaaaacaagcattagaagcggccgtt
aagcgccaactgatgacagatgtaccttatggggttttgctttctggaggattggactct
tcaattacgtcagccattgcgaaacgttacgccgcaatgcgaattgaagatgatgaacaa
tcagaagcatggtggccacagcttcactcttttgcggtgggtttagacggtgctccagac
cttaaagcggctcgtgaagtggctgaaaaaattggcactgtacaccacgaaatgacttat
accatccaagagggtttagatgctattcgtgatgttatttaccatattgaaacgtatgac
gtgacgacaattcgagcctctactccgatgtatttgatggggcgaaaaatcaaagctatg
ggtatcaaaatggtactttccggcgaaggagcggatgagatcttcggtggttacttatac
ttccacaaagcaccaaacgcgcaagaattccacgaagaaactgtgcgtaaactgctggcg
ttgaacttgtttgactgtgctcgcgctaataaatctttagcggcttggggagtggaagga
cgcgttcctttcctagacaaagagtttattgatgttgcaatgaggcttaaccctgctgac
aaaatgtgtggcaatggcaagatggaaaaacacattctacgtgagtgctttgaagattat
ctgccagcctcgattgcttggcgtcaaaaagagcaattttccgatggtgtgggctatagc
tggattgacacactaaagagtgttgctgaagaaaaagttaccgatcaacagatggaaaca
gcaaaataccgcttcccatataatactccagcgacaaaagaagggtatgtttaccgcgag
atcttcgaagagctgttcccgttagagtctgctgcacaatgcgttcctggaggtccttct
gtagcttgttcttccgccaaagcaattgagtgggatgaatcctttaaaaattgtattgac
ccgtcaggccgagctgtcaaagcggtgcataatgaagcgtactaa

DBGET integrated database retrieval system