KEGG   Vibrio anguillarum 775: VAA_02143Help
Entry
VAA_02143         CDS       T01536                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
van  Vibrio anguillarum 775
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VAA_02143
  Lipid metabolism
   00561 Glycerolipid metabolism
    VAA_02143
   00600 Sphingolipid metabolism
    VAA_02143
Enzymes [BR:van01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VAA_02143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1962835..1964571)
Genome map
AA seq 578 aa AA seqDB search
MTTITLPCHREVELLQPDLIAQLQGDEISFSYSGIHNSPISDHYSLFRTLFDVESDARVI
GDGFQMLAQTAGSPHHPVDVGRCPDNSLSYRIYPLQDSQRYYNTLVIEQSTGYQLFGFTS
CHRFAGYFEILEERTGTYLVASIDGEQTHPQDWTNNSLESVVILQGDSLSGLYQQYAQYI
SCHHTPRAGVAQPAPVGWCSWYAYYADVNEQHILTNLAAMQGELSGLEWVLLDDGYQAFM
GDWLTPSDKFSRGVKVLIQEIKQAGKKPAIWLAPFIAQAESQLFKQHPDWFVQNAQRQPL
KAEEVTYGGWRCTPWYVLDGSHPDVQEYLTHVIKTMKEEWGVELFKLDANYWGALKGRRY
QSGVTGVEAYRLGMQAIAEGAGEAWLLGCNAPMWPSLGLVDAMRISDDVERSPQRFEQIA
KETFYRSWQHRKLWQIDPDCATLTSLANQSTDRISYEFHRNVLLACGGLLLSGDPLPELT
SFAKQSLNKLMIRRKHNQDAAKPTSLALNHLFLKLTERNDLHCLFNYQGEACDYTLTASQ
PVDWYDYWTGDKLSPEPVKVFEVSLASGLTSRAVITSC
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatcactctgccatgtcatcgagaagttgagttacttcaaccggatttgatt
gcccaattgcaaggcgatgagatcagtttttcctattcaggaatacataactcgcccatt
tccgatcactactcgctgtttcgcactctatttgacgttgaatcggacgcacgagtgatt
ggtgacggttttcaaatgctagcgcaaactgcaggttcgccgcatcatccggtggatgtg
gggcgttgccctgacaatagcttgagctaccggatttacccgctgcaagacagccaacgt
tattacaacacgctggtgattgaacaatccaccggataccaactgtttggttttacctct
tgccaccgttttgctggctattttgaaattcttgaggaaaggacgggcacctatttagtc
gcttccattgacggcgagcagacccatccacaagattggacaaataacagtttagaatcc
gtcgttattttgcaaggtgattcattatcaggtttgtatcaacagtatgcgcaatatatt
agttgtcaccatacgccgcgtgctggtgtggcacaacctgcgcccgttggatggtgttca
tggtatgcctattatgccgatgttaatgaacagcacatcctaaccaaccttgcggcaatg
caaggagaactttcggggctagaatgggtgttgctggatgatggctatcaggcgtttatg
ggcgattggttgacgccgtccgataagttttctcgtggtgttaaagtgctgatccaagag
attaaacaagcgggcaaaaaacccgcaatttggctcgctcccttcattgcacaagctgaa
tctcaattgtttaagcaacatccagattggtttgtacaaaatgctcaaagacaaccactg
aaagctgaagaagtaacctacggtggctggcgctgtacaccttggtatgtgctggatggc
tctcatcctgacgtgcaggaatacttaacccatgtgataaaaactatgaaagaagagtgg
ggggttgagctgtttaagttggatgcgaactattggggagcacttaaaggacggcgttat
cagtcgggagtgacgggtgttgaagcgtaccgtttagggatgcaggcgatagcagaaggc
gcgggagaggcatggttacttggatgtaacgcgccgatgtggccgtcactgggtttagta
gatgccatgcgtatttcggacgatgtcgagcgttcgccacagcgctttgaacaaatcgct
aaagagactttttatcgcagttggcagcaccgcaagttatggcaaattgatcctgattgc
gcaacactgacgtcgcttgcgaatcaatcgaccgatcgcatcagctatgaatttcatcgc
aatgtattgcttgcgtgtggtggcttgttgctttcaggtgatccactcccagaattgacc
tcttttgctaagcagagcctaaataagttaatgattaggcgcaaacacaaccaagatgcg
gctaagccaacttcattggctctcaatcacctatttttaaagttaacagaacgcaatgat
ctgcactgcttattcaattaccaaggtgaggcgtgtgactataccttaacagcgagccag
ccagtggattggtatgactactggacaggagataagctttcgccagagccagtcaaagta
tttgaagtctccttggcaagtggcttaaccagccgagcagtgattacctcttgttag

DBGET integrated database retrieval system