KEGG   Vibrio anguillarum 775: VAA_02250Help
Entry
VAA_02250         CDS       T01536                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
van  Vibrio anguillarum 775
Pathway
van00400  Phenylalanine, tyrosine and tryptophan biosynthesis
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01130  Biosynthesis of antibiotics
van01230  Biosynthesis of amino acids
Module
van_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAA_02250
Enzymes [BR:van01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VAA_02250
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VAA_02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEH33510
UniProt: F7YLB1
Position
I:2072888..2074297
Genome map
AA seq 469 aa AA seqDB search
MPEQLSDHISTQHTQMAEVLAKIVNDKYEWVEQRKTQQPLGSFEHLLTASDRSFYDALNT
GKTAFILECKKASPSKGLIRQDFDLDYIASVYHQYADAISVLTDEKYFQGNLEFLPRVRA
QVSQPVICKDFMVDVYQVYLARHYSADAILLMLSVLDDQHYQTLANVAHQLGMGILTEVS
NEEELHRAVALQAKVIGINNRNLRDLSTDLNRTKQLAPLLPEGTMIISESGIYTHQQVRE
LSQYANGFLIGSSLMAEENLELAVRKVTLGENKVCGLTHADDAAKAYQAGAVFGGLIFVP
QSKRYVDLDNARLTMSGAPLRYVGVFQNHTIEAITQIATTLKLFAVQLHGEEDQAYVDQL
RAHLPSQIEIWKAYGVSDCLPTKLERHIDRHLFDAKVGTQSGGTGQRFDWQLLTKINDVM
LAGGLSPENAQQAANIGCLGLDLNSGVESEPGKKDLHKLTLAFDAIRQY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcaactttctgaccacatttcaacccagcatactcaaatggctgaagtgttg
gccaaaatcgtcaatgacaaatatgaatgggtcgagcagcgtaaaacgcagcaaccattg
ggcagcttcgaacacttattaaccgcatcggatcgctcgttttatgatgcgttaaatacg
ggtaaaaccgcttttattttggagtgtaaaaaagcctcaccttccaaagggctcattcgc
caagattttgatttggattatatcgcttcggtttaccatcaatatgcagacgccatttca
gttttgactgatgaaaaatatttccaaggcaacctcgaatttctgccacgcgttcgcgcg
caagtaagccaacctgtgatttgcaaagactttatggttgatgtttatcaggtttatttg
gctcgtcactacagtgcagatgccattttattgatgctgtccgtccttgatgatcaacac
tatcaaacgctagccaatgtggctcaccaattgggtatgggtattttaaccgaagtgagc
aatgaggaagagctgcaccgggcagtcgccttgcaagcaaaagttattggcattaataac
cgcaacttgcgcgatctctcaaccgatctaaatcgcactaaacagctggcacctttactc
ccagaaggaaccatgatcatctcggagtctggtatttatactcaccaacaagtgcgtgaa
ctttcgcaatacgccaatggatttttaatcggcagctcgttaatggccgaagaaaattta
gagctagcggtacgtaaagtgacgctcggcgaaaacaaagtgtgcggcttaactcatgct
gacgatgcggccaaagcctatcaagctggagccgtgtttggtggcttaatttttgtgccg
caatccaaacgctatgtcgacttggacaatgcacgtttgacgatgagcggcgcgccgctg
cgctacgtgggcgtgtttcaaaatcacaccattgaagccattacgcagattgctacgacg
ttaaaactcttcgcggtgcaactgcatggcgaagaagatcaagcctatgttgaccaattg
agagctcacttacctagccagattgagatctggaaagcttatggcgtgagcgactgccta
ccgaccaagcttgagcgccacattgaccgtcacttattcgatgccaaagtaggaacgcaa
tctggcggcactggccaacgttttgactggcaattactaaccaagataaacgatgtcatg
ttggcgggtggcttatcccctgaaaatgctcagcaagcagcaaacatcggttgtttaggg
ctcgatctcaattcaggtgttgagagcgagccggggaaaaaagacttacacaagctaacc
ctagcgttcgacgctattcggcagtactaa

DBGET integrated database retrieval system