KEGG   Vibrio anguillarum 775: VAA_02251Help
Entry
VAA_02251         CDS       T01536                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
van  Vibrio anguillarum 775
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAA_02251
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAA_02251
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAA_02251
Enzymes [BR:van01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAA_02251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:2074429..2075619
Genome map
AA seq 396 aa AA seqDB search
MAKLDAYFGEYGGQYVPQILVPALDQLEQAFIDAQEDPEFRAEFMTLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSATY
ETTHYLLGTAAGPHPFPTIVREFQRMIGEETKLQILAREGRLPDAVLACVGGGSNAIGMF
ADFIEEKNVRLIGIEPAGKGIHTHQHGAPLKHGKTGIFFGMKSPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLYATGRAEYESITDDEALDAFQSIARNEGIIPALESSHAVAYAVKM
AYAEPEKEQLLVVNLSGRGDKDIFTVHKLLEEKGAL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactagatgcctattttggcgaatacggtggtcaatacgttccacaaatttta
gtaccagcgcttgaccaattggaacaagcttttattgatgcgcaggaagatcctgaattt
cgtgctgaattcatgacgttactacaagagtatgcaggtcggccaacggcgctaactttg
acgcgaaacctcacgaaaggcacaaaaaccaaattgtatttaaaacgtgaagacttattg
cacggtggcgcacacaaaaccaaccaagtacttggtcaggcactgcttgctaagcgtatg
ggtaaacatgaaattattgccgaaacaggcgcagggcaacatggtgttgcaacagcgttg
gcctgcgcactactggggctaaaatgtcgcgtttatatgggtgcaaaagatgttgaacgc
caaagccccaacgtgtttcgtatgaagctaatgggggcagaagtgatccccgttcattca
ggatcagcaacacttaaagatgcgtgcaatgaagcgctacgtgactggtctgccacctat
gaaaccacccactatttattaggtacagcagcgggtcctcacccatttccaaccatagtc
cgtgaatttcaacgcatgattggcgaagaaacgaaactgcaaattttggctcgcgaaggt
cgtttaccagatgcggtgcttgcttgtgtcggcggcggttcgaacgcgattggcatgttt
gctgactttattgaagaaaagaatgtccgtttgattggcattgagccagcaggaaaaggc
attcatacccaccagcatggcgcgccattgaagcacggcaagacaggtattttcttcggc
atgaaatcacctttgatgcaagatgaaaacgggcaagtagaagagtcttactcggtgtcc
gctgggcttgacttcccttctgttggccctcagcacgctcatctttatgcgacaggccgc
gctgagtacgaaagcattaccgatgacgaagcactcgatgctttccaatcgatcgcacgt
aacgaaggtattattcccgcgctggaatcatcacatgcggttgcttacgccgtgaagatg
gcgtatgccgagccagaaaaagagcagttattggtcgtgaatctatccggtcgcggcgat
aaagatattttcaccgtccataaactattagaagagaaaggagcgctgtaa

DBGET integrated database retrieval system