KEGG   Vibrio anguillarum 775: VAA_02252Help
Entry
VAA_02252         CDS       T01536                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
van  Vibrio anguillarum 775
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAA_02252
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAA_02252
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAA_02252
Enzymes [BR:van01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAA_02252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:2075619..2076425
Genome map
AA seq 268 aa AA seqDB search
MDRYQTLFQRLADNNQGAFVPFVTIGDPDPEQSLRIMQTLVEAGADALELGIPFSDPLAD
GPTIQGANIRALDAGTTPDICFELITKIREQYPDLPIGLLMYANLVYSRGIENFYQRCKN
AGVDSVLIADVPTNESREFVAAADKYGIQPIFIAPPTASDETLAAVAKLGRGYTYLLSRS
GVTGAETKANMPVHALLERLNQFDAPPALLGFGISEPEQVKQAITAGAAGAISGSAVVKI
IEQRLTQPDEMLTTLSHFVSSMKAATLK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctatcaaaccctatttcagcgtttagctgacaacaatcaaggtgcgtttgtt
ccatttgtgaccatcggggacccagatccagagcaatcactgcgcatcatgcaaacgcta
gtggaagcaggagcagacgcattagaactcggtatccctttctctgatccgctcgctgat
ggcccaaccatccaaggggcgaatattcgtgcactggatgcagggacgactccagatatc
tgctttgagttgatcaccaaaattcgcgagcaatatcctgacctgcctatcggactactc
atgtatgccaacctagtttattcacgcggcatcgaaaacttctaccaacgctgtaaaaat
gcgggtgtagattcagtattgatcgccgatgttccgactaatgaaagccgtgaatttgtc
gcggcggcagacaaatacgggattcaacccattttcatcgcaccacccaccgccagtgat
gagaccctagccgcggtcgccaaacttggccgtggctatacttatctactgtctcgatcc
ggtgtgacaggagcagaaacaaaagccaatatgccagtacatgccttgttggaaagactg
aaccaatttgatgccccacccgcattgcttgggtttgggatatcagaacctgagcaagtc
aaacaggccatcaccgccggtgccgctggcgcaatatcgggatccgcagtggtgaaaatt
attgaacaacgacttactcagccagatgaaatgttaacgactctcagccatttcgtttcc
agcatgaaagcagcaacgttgaaataa

DBGET integrated database retrieval system