KEGG   Vibrio anguillarum 775: VAA_02345Help
Entry
VAA_02345         CDS       T01536                                 

Definition
(GenBank) Aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
van  Vibrio anguillarum 775
Pathway
van00010  Glycolysis / Gluconeogenesis
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01120  Microbial metabolism in diverse environments
van01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAA_02345
Enzymes [BR:van01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VAA_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEH33601
UniProt: F7YLW9
Position
I:2174409..2175293
Genome map
AA seq 294 aa AA seqDB search
MDLQSLPTLTYLSDNVTIVEKEGVKIVRVIHDKATAGITLHGGHVISFTPKGQDELIWMS
DTAIFDGKAALRGGIPVCWPWFGRIAAPAHGFARTSEWALIEHRENEQGVIIVLGLDHSP
QTLAIWPFQFQTRLYVEIGDKLKVTLETTNTDEKAWTFSAALHSYLKVGNITQTTTTGMG
VEYIDSLQDAKMCQGGSTLILTDTIDRVYTAPEAQIQVQDPVLNRTLVVENTGHNSAVLW
NPWAQGAQSMADMPDDGYQTMLCVESTLHAPCLSAGKTLQPGESHQLVTTVFSN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcaatctctccctaccctgacttatctttctgacaacgtcaccatcgttgag
aaagagggcgttaaaattgttcgcgttattcatgacaaagcgaccgccggaattacactg
catggcggccatgtcatctcattcactcctaaaggacaagatgagctcatttggatgagt
gacacggccatttttgacggtaaagccgctctaagaggcgggatccctgtttgttggcca
tggtttggccgtattgctgcaccagcccatggtttcgcacgcaccagtgaatgggcattg
attgaacatagagaaaacgagcagggcgtcattatcgtgctagggctcgaccattcgccc
caaacactggctatttggccatttcaattccaaactcgtctttatgttgaaattggtgac
aagttaaaagtcactttagaaacgaccaatacggatgagaaagcatggacgttttctgca
gcgctgcacagctacctcaaggttggtaatattacccagaccactactacaggtatgggc
gttgaatatatagacagcttacaagatgcaaaaatgtgtcaaggtggttcaacactcatc
ctcaccgatacgattgatcgcgtctataccgcgcctgaagcacaaattcaggtccaagat
cctgttttgaatcgtacgttagtggttgaaaacactggacacaactctgccgtcttgtgg
aacccatgggctcaaggcgctcaatcaatggcagatatgcctgacgatggttatcaaacg
atgctgtgtgttgaatctacactgcatgccccttgcttgtccgcaggaaaaaccttgcaa
ccaggtgaaagccatcagctcgtcacgacggttttttccaactaa

DBGET integrated database retrieval system