KEGG   Vibrio anguillarum 775: VAA_02577Help
Entry
VAA_02577         CDS       T01536                                 

Definition
6-phosphofructokinase 1
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
van  Vibrio anguillarum 775
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:van00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAA_02577
   01230 Biosynthesis of amino acids
    VAA_02577
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAA_02577
   00030 Pentose phosphate pathway
    VAA_02577
   00051 Fructose and mannose metabolism
    VAA_02577
   00052 Galactose metabolism
    VAA_02577
  Energy metabolism
   00680 Methane metabolism
    VAA_02577
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VAA_02577
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VAA_02577
Protein phosphatases and associated proteins [BR:van01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VAA_02577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:534199..535167
Genome map
AA seq 322 aa AA seqDB search
MSMIKKIGVLTSGGDAPGMNAAIRGVVRTALGADLEVFGIYDGYLGLYEDRIKKLDRSSV
SDVINKGGTFLGSARFPEFREVAVREKAIENLRKHGIDALVVIGGDGSYMGAKKLTEMGF
PCVGLPGTIDNDIAGTDYTIGYLTALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLT
LMSAIAGGCEYIITPETGLNMEQLIANVQDGIKKGKKHAIIALTELMMDANQLAKEIEKA
TGRETRATVLGHIQRGGRPTAFDRVLASRMGNFAVHLLLDGHGGRCVGIQKEQLVHHDII
DAIENMKRPVRTDLYKVAEELF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatgattaagaagatcggtgttttgactagtggcggtgacgcacctggcatgaac
gcagcaatccgtggtgttgttcgtacggcactcggtgctgatttggaagtatttggtatt
tacgatggctaccttggtctttatgaagatcgcattaaaaaattggatcgttcaagcgtt
tctgacgttatcaataaaggtggtactttcctaggttctgcgcgtttccctgaatttcgt
gaagtcgcagtacgtgaaaaagcgatcgagaacctaagaaagcatggtattgatgcttta
gttgtcatcggcggtgacggttcttacatgggtgcgaaaaagctgaccgaaatgggtttt
ccatgcgttggtttaccaggcacgattgataacgacattgcaggtaccgattacaccatt
ggctacttaacagcattaaatacggttatcgatgcgattgaccgtttacgtgatacttcc
tcttctcatcaacgtatttctattgttgaaattatgggtcgtcattgcggtgatttgact
ctgatgtcggcaattgcaggcggttgtgaatacatcatcacccctgaaactggcctgaat
atggagcaactgattgcaaatgttcaagacggtattaagaaaggtaagaaacacgccatt
attgcactgactgagttgatgatggatgctaaccaactggcgaaagaaattgaaaaagca
acgggacgtgaaactcgcgctaccgtgctgggtcatattcaacgcggtggtcgcccgacg
gcgtttgaccgtgttcttgcgtcacgcatgggtaattttgcagtacatttactgcttgat
ggccacggtggtcgttgtgttggtattcagaaagagcagttggttcaccacgatattatc
gacgcaattgaaaatatgaagcgtccagttcgcactgatttgtataaagtggctgaagag
ctgttttaa

DBGET integrated database retrieval system